KEGG   Shinella sp. HZN7: shn_28980Help
Entry
shn_28980         CDS       T04278                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
shz  Shinella sp. HZN7
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:shz00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    shn_28980
Enzymes [BR:shz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     shn_28980
Transporters [BR:shz02000]
 Other Transporters
  Pores ion channels [TC:1]
   shn_28980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
pShin-03:complement(379333..379947)
Genome map
AA seq 204 aa AA seqDB search
MKLYHHPLSGHCHRARLFLSLLGLSHDLVEVDLKSGAHKKPDFLEMNPFGQVPVLDDGGV
FISDSNAILVYLAKKAARTDWLPEDAKGAAAVQRWLSVAAGEIAYGPAAARLITVFGAKF
NPEEVINRAHTVLGRMESQLTGRDWLVGDRPTIADVAIYSYVARAPEGNVDLSDYPAVGA
FLRRVEALPGFVDFVRTPVGLAAA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttatcaccatccgctgtcgggccattgtcaccgggcacgcctcttcctctcg
ctgctcggcctgtctcatgacctggtcgaagtcgatctcaagtcgggcgcacacaagaag
ccggacttccttgaaatgaacccgttcggccaggtccccgtcctcgatgacggtggtgtc
ttcatttccgattccaacgcgatcctggtctacctcgcgaagaaggccgcccgcaccgat
tggctgccggaagatgcgaagggtgccgccgccgtccagcgctggctgtcggttgccgcc
ggcgaaatcgcctatggcccggccgccgcgcgactgatcacggtcttcggcgccaagttc
aatccggaagaagtcatcaatcgcgcgcacacggtactgggcagaatggaaagccagctc
accggtcgcgactggctggttggcgaccgcccgacgatcgcagacgtcgccatctacagc
tatgtggcacgcgctcccgaaggaaacgtcgatctttcggactacccggccgtcggcgcc
ttcctccgccgtgtggaagcgctgccgggttttgtggatttcgtccgcacgccggtcggc
ctcgcagcagcctga

DBGET integrated database retrieval system