KEGG   Streptococcus intermedius JTH08: SCIM_0786Help
Entry
SCIM_0786         CDS       T02156                                 

Gene name
amy
Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
sie  Streptococcus intermedius JTH08
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sie00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCIM_0786 (amy)
Enzymes [BR:sie01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SCIM_0786 (amy)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(913698..915146)
Genome map
AA seq 482 aa AA seqDB search
MENQTLMQYFEWYLPNDGQHWNRLAKEAPHLASKGIRKVWMPPAFKATSSNDVGYGIYDL
FDLGEFNQKGTVRTKYGLKEEYLKAIKSLKENGIEPIADVVLNHKAAADYKERFTVIEVD
PNDRTVALSEPFEIKGWTKFTFPGRHKKYNNFEWHWYHFTGTDYDAQRNKSGIYLIQGDN
KGWADDDLVDNENGNFDYLMYADLDFKHPEVIQNLYDWADWFIKTTGIHGFRLDAIKHID
SFFMGNFIRDISAKYGDDFYVFGEFWNSDETANNDYLGSIDYRFDLVDVKLHHNLFDASC
AGSGYDLRNIFEQTLVKNHPESAVTFVDNHDTQRGQALESTIEEWFKPAAYALILLREAG
LPCVFYGDYYGVNGEFAQDSFQTVLDKLLDIRLNLAYGEQKDYFDDEHCIAWTRSGKDNG
QPIAVILTNDQANSKRMYVGENWAGKEFKDYLGNNPSTVIIKEDGWANFPVVEKSVSVWS
AK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcaaacattaatgcaatattttgaatggtatctaccaaatgatggacaacat
tggaatcgcttagcaaaagaggccccacatctagcttctaaaggaattcgaaaggtttgg
atgccgcctgctttcaaagcaactagctccaatgatgtcggctacggtatttatgatcta
ttcgacttaggggaatttaaccaaaaaggtaccgttcggacgaagtacggcttaaaagaa
gaatatttgaaagctattaagtcgctcaaagaaaatgggatcgagcctattgcagatgtc
gttttaaatcacaaggcagcagcagattacaaagagcgatttactgttattgaagttgat
ccaaacgatcgtacagttgcactctctgaacctttcgaaattaaaggttggactaaattc
acgttcccaggtcgccacaaaaaatataataattttgagtggcattggtatcactttact
gggactgattatgatgctcaacggaataaatcagggatttatctcattcaaggagacaat
aaagggtgggcagatgatgacttagttgataatgaaaatggcaattttgattatctcatg
tatgctgaccttgactttaaacatccagaagtaattcaaaacctttatgattgggcagat
tggttcatcaaaacaacaggcattcatggcttccgactagacgcaattaaacatatcgac
tctttctttatgggaaattttatccgcgacatctcggctaaatacggggacgatttctat
gtctttggagagttttggaatagtgatgaaacagcaaacaacgattatttaggaagtatt
gactatcgttttgatttagtagatgtcaaactacatcataatttgtttgatgctagctgt
gctggatctggctatgatttaagaaatatttttgaacaaactctcgtcaaaaaccaccct
gaatctgcggttacttttgttgataaccatgatacacaacgcggtcaagcgctggaatca
actattgaagagtggtttaaacctgctgcttatgcccttattttattacgcgaagcaggc
cttccttgcgttttctacggagactactatggcgtcaatggggaatttgctcaagacagc
ttccagacagttcttgataaattattagatatccgtctcaatctagcttatggtgaacaa
aaagattattttgacgacgagcattgtattgcttggactcgttcaggcaaagacaatgga
cagccaattgccgttattttgacaaatgatcaagcaaattcaaaacgcatgtatgtcggg
gaaaactgggctggcaaagaattcaaagactacttaggaaacaacccttcaactgtgata
atcaaggaagacggctgggcaaatttcccagttgtagaaaaatcagttagcgtctggtct
gcgaaataa

DBGET integrated database retrieval system