KEGG   Streptococcus infantarius: Sinf_1334Help
Entry
Sinf_1334         CDS       T01765                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sif  Streptococcus infantarius
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sinf_1334 (ppc)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sinf_1334 (ppc)
  Energy metabolism
   00680 Methane metabolism
    Sinf_1334 (ppc)
Enzymes [BR:sif01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Sinf_1334 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1366062..1368884)
Genome map
AA seq 940 aa AA seqDB search
MTIQKLENNDTQSIITEEVKVLKSLLDETTHQMVGDEVFAKIQNIVKLSASDEYDKLEEL
VAQLTNEEMVVVSRYFSILPLLINISEDVDFAYEINYQNNTNQDYLGKLSMTVDMVSESE
NSKEILENVNVVPVLTAHPTQVQRKTVLELTNHIHDLLRKYRDVKAGVVNRDKWYTDLRR
YIEIIMQTDIIREKKLKVKNEITNVMEYYNGSLIQAITKLTSEYKRLAAEKGIDLTNPKP
ITMGMWIGGDRDGNPYVTAETLHLSATVQSEVIINYYIEKLTGLYRTFSLSTTLTKISPE
VERLAELSSDKSIYRENEPYRKAFNYIQSKLIQTLIELKAGPTISCRALENSKLGSDVYA
NTNNASVIAKYLQNKVNKVSSELQDEIPSYKTAKEFKDDLLIIKQSLLDNGDDALLTGDF
SELLQAVDVFGFYLATIDMRQDSSVNEACVAELLKSANIVDDYSALSEEEKVKVLLKELQ
EDPRTLSSTNAEKSEQLQKELAIFQTARYLKDKLGDEVIKQHIISHTESVSDMFELAIML
KEVGLLDKQKARVQIVPLFETIKDLENSRGIMEEFLDYDIVRRWVTANKGYQEIMLGYSD
SNKDGGYLSSVWTLYKAQNELTRIGSERGIKVTFIHGRGGTVGRGGGPSYEAITSQPFGS
IKERIRLTEQGEIIENKYGNKDVAYYNLEMLLSATVDRIVTRMITNPDEIDTFRETMDSI
VTYSNGVYRDLVFGNPHFYDYFFEATPIKEVSSLNIGSRPAARKTITEISGLRAIPWVFS
WSQSRIMFPGWYGVGSAFKHFIDAEEGNLEKLQHMYEKWPFFHSLLSNVDMVLSKTNMNI
AFQYSKLAESEEVRNVFNVILDEWQLTKDVILAIEKHDNLLEENPSLRASLDYRIPYFNV
LNYIQIELIKRLRHDELDEDYEKLIHTTINGIATGLRNSG
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
gtgacaatccaaaaactggagaacaatgatacccagtcgatcattaccgaggaagtcaaa
gtactaaaaagcttactcgatgaaacaacccatcaaatggttggtgatgaggtattcgct
aaaattcaaaacattgttaaattgtcagcaagtgatgaatatgacaaacttgaagaacta
gtagctcagttgaccaacgaagagatggttgttgtgtctcgttatttttcaattttgcca
ctgttaatcaacatttctgaagacgttgactttgcttatgaaatcaactaccaaaataat
acaaatcaggattatcttggcaaactctctatgactgttgacatggtttcagaaagtgaa
aactctaaagaaatccttgaaaacgtaaatgttgtacctgtattgactgctcacccaaca
caagttcaacgtaaaacggtccttgaattaacaaaccatattcacgaccttttgcgtaaa
taccgtgatgtgaaagcaggagtagttaatcgtgataaatggtacactgacttacgccgt
tatattgaaatcatcatgcaaacggacatcattcgtgagaaaaaacttaaggtaaaaaat
gaaattaccaatgtaatggaatattacaatggatccttaatccaagcgattactaagttg
acatcagagtacaaacgtttggctgctgaaaaaggtatcgaccttacaaatccaaaacct
atcacaatgggtatgtggattggtggtgaccgtgatggtaacccatacgtaactgctgaa
actcttcatttgtcagctactgttcaaagtgaagtcatcatcaattactacattgaaaaa
ttgacaggtctttaccgcacattctcactttcaacaacgttgactaaaatcagccctgaa
gttgaacgtttggcagaattatcaagcgataaatcaatttatcgtgaaaatgaaccatac
cgtaaagctttcaactatatccaatcaaaattgattcaaacattgattgaattgaaagct
ggtccaactatttcatgtcgtgcacttgaaaatagtaaacttggttcagacgtttacgca
aacactaacaacgcaagtgttattgctaaatatttgcaaaacaaagttaataaagtttca
tcagaacttcaagatgaaattccaagttataaaactgctaaagaatttaaagacgacttg
ctcatcatcaaacaatcattgcttgataatggagacgatgctctcttgacaggtgacttt
agcgagttacttcaagctgttgatgtctttggcttctaccttgcaacaatcgatatgcgt
caagattcaagcgtcaatgaagcttgtgtcgcagaattgttgaaatcagcaaatattgtt
gatgactacagcgctctttctgaagaagaaaaagttaaagtccttcttaaagaattgcaa
gaagacccacgtacattgtcatcaacaaatgccgaaaaatcagaacaacttcaaaaagaa
ttggctatcttccaaacagctcgttaccttaaagataaattaggtgatgaagttatcaaa
caacacattatttcacacactgaaagtgtttctgatatgtttgaattggctatcatgctt
aaagaagttggacttcttgataagcaaaaagcgcgtgttcaaatcgtaccactttttgaa
actatcaaagaccttgaaaactcacgtggtatcatggaagaattccttgattatgatatc
gttcgtcgttgggttacagctaacaaaggttaccaagaaatcatgcttggttactcagat
agtaacaaagacggtggttacctatcatctgtatggacactttacaaagctcaaaatgaa
ttgactcgcatcggttcagaacgtggtattaaagtgacattcatccatggtcgtggtggt
actgtcggtcgtggtggtggtccatcatatgaagcaatcacatcacaaccatttggttct
attaaagaacgcattcgtttgacagaacaaggtgaaatcatcgaaaacaaatacggaaat
aaagacgttgcttactacaaccttgaaatgttgctttcagcgacagttgaccgtatcgtt
actcgtatgattacaaatccagatgaaattgatactttccgtgaaacaatggatagcatt
gtgacatactcaaatggcgtttaccgtgatttggtatttggtaatccacatttctacgat
tacttcttcgaagctactccaattaaagaagtatcaagcttgaatattggttcacgtcca
gctgctcgtaagacaatcacagaaatctctggtcttcgtgcaattccttgggtattctca
tggtcacaaagtcgtatcatgtttccaggatggtatggtgttggttcagccttcaaacat
ttcatcgatgctgaagaaggaaaccttgaaaaacttcaacacatgtatgaaaaatggcca
ttcttccattcacttctttcaaatgtagacatggtattgtctaaaacaaatatgaatatt
gctttccaatattctaaattggctgaaagtgaagaagttcgtaatgtcttcaatgttatt
cttgacgaatggcaattgacaaaagatgttatcttggcaattgaaaaacatgataacttg
ttggaagaaaatccatcacttcgcgcaagtttggattatcgtattccatactttaacgtt
ttgaactacattcaaattgaattaattaaacgtttgcgccatgatgagttggacgaagat
tacgaaaaactcattcacactacaattaacggtattgccacaggattacgtaattctggc
tga

DBGET integrated database retrieval system