KEGG   Sulfolobus islandicus HVE10/4: SiH_0069Help
Entry
SiH_0069          CDS       T01952                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sih  Sulfolobus islandicus HVE10/4
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sih00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SiH_0069
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    SiH_0069
   00680 Methane metabolism
    SiH_0069
Enzymes [BR:sih01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SiH_0069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
60944..62479
Genome map
AA seq 511 aa AA seqDB search
MRIIPRTMSTQHPDNAKVPEWAKSEVIEGEDEVKEAFLAYSMYGVHEVMWDAEGKDVDTH
VVRKLLSNYPDYFREHILGKDVFLTYRLPNPKVEGADRKVFAETMESIPITYDLAEKFYG
NGITVPVFEVILPMTTSNLEIISVARYYEKAVANEDELELYDGVKVKDLVGEIYPKVIEV
IPLVEDRDSLQNIDNIVEGYYKVIKPKYMRVFLARSDPAMNYGMITAVLSVKIALSELYK
LSESLNFEIYPIIGVGSLPFRGHLSPENYEKVLEEYKGVYTYTIQSAFKYDYDYDKVKSA
ISSINNSRIGPAKILEKYEEDVLRKITILYTERYQPIIESLANAINDVSMLLPRRRARKL
HIGLFGYSRSAGKVSLPRAISFVGSLYSIGIPPELIGISSLSNLDEKEWDIFKQNYVNFK
HDLQTAARFFNWESFELIKDIWKISEDTIAKIKEDIDYAESVIGIKLGDIDYDSRKHILM
SSLFLLSFKEKILQESKKYLYEMALIRRSLG
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcataccacgtactatgtcaacacaacatcccgataatgcgaaagtaccagag
tgggcaaaaagcgaagttattgaaggagaagatgaagttaaagaagccttcctagcttat
agtatgtatggagttcatgaggtaatgtgggatgctgagggaaaagacgtagatactcat
gtggtaagaaagttattgtcaaattatccagactactttagagaacatattttaggtaaa
gatgtatttttaacttataggttacctaacccaaaggtggaaggtgctgatagaaaagta
tttgccgaaaccatggagagcattccaataacttatgatttggcagagaaattttacggt
aatgggattacggtaccagtttttgaagtaattttaccaatgacaactagtaatttggag
ataataagtgtggctaggtattacgaaaaagcagttgcaaatgaagatgaactagaactt
tacgatggtgtaaaagtaaaggatttagttggagaaatatatcctaaagtaatagaagtt
ataccactagtcgaagatagggactctcttcaaaatattgacaatatagtggaggggtat
tataaggtaattaaacctaagtatatgagagtctttttagccaggtcggatccagcaatg
aattatggaatgataacagctgttctgtcagtaaagattgccttaagtgagttatacaaa
ctttcagaatcgttaaactttgaaatatatccaataattggtgttggttcacttccattt
agaggccatttatctcctgaaaactatgaaaaagtattggaagagtataagggagtttat
acatatacgattcaatcagcgtttaagtatgactatgattacgacaaagtaaaaagtgct
atttcttcaataaataactcacggattggcccagctaaaatattggaaaagtacgaggag
gatgttctaagaaagataacgatcttatatactgaacgttaccagccaattatagaaagt
cttgcaaacgctataaatgacgtctccatgttacttcctagaagaagagccagaaaactt
catattggcctttttggatattctagaagcgcaggcaaggttagcttacctagggcaatt
tctttcgtgggttcactatattcaataggaataccaccagaactaataggaatttcgtct
ttaagcaatttagatgagaaagagtgggatatattcaaacagaattacgttaattttaaa
cacgatctccaaactgctgcgagattctttaattgggagtcgttcgaattaattaaggat
atatggaaaattagtgaggatactatagcaaagatcaaggaagatatcgattacgctgag
agcgtgataggcataaaattaggcgacatagattacgatagtagaaaacacatcctaatg
tcttcgctatttttactatcatttaaagagaaaatccttcaagaatctaagaagtattta
tatgagatggcattaattagaagatccttgggatga

DBGET integrated database retrieval system