KEGG   Streptococcus iniae SF1: K710_1941Help
Entry
K710_1941         CDS       T02686                                 

Definition
(GenBank) neuraminidase A
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
sik  Streptococcus iniae SF1
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sik00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    K710_1941
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    K710_1941
Enzymes [BR:sik01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     K710_1941
Bacterial toxins [BR:sik02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   K710_1941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1885232..1887940)
Genome map
AA seq 902 aa AA seqDB search
MNKNSKKLFEKRQRFSIRRLSIGVGSVLIGICLFGTPLVSAEELRPTQPGLVTSSVTDLS
PASHQKESDITQVNDLKVSDKAIVETEPTLSVTDNTIRLDLSNDDKKRKEILSEGQFASD
QVQQANPIAEAYKENEVFKIDNQVLQKNSKIDLSEHLDALKKLDSATIYAEIKTPEDMDD
FMTWFSVSTSANENERFYLYITKEGVVGVEGADNANKPFYKSFTSASQRVKPSEWNALAF
VINQEAQKVQIYVNGILSQEDSTSTQFIKDLANPEFAQIGQTQRGRSNKWGFSHFDIKNF
TVYNRALSETEVGDRSQLFIRGKNHVTLAEGAELSDKQDVYQSGYIKRKNQDGVYAYRIP
ALLKTDKGTLIAGADERFNHSSDWGNIGMVIRRSEDNGKTWSDRNTLVNLRDNPKAAVAE
ENSPVNIDMVLVQDPTSKRIFSIYDMFPEGRGIFGMSKKQEVEYTKHGDKTYMNLYREDG
KGDGVYTIREGGYVYTPQGAKTNYRVITASDKKDRSDLGDLYQDQDLIGNVYFTSHKTSP
FRIAKSNYLWLSYSDDDGKTWSSPRDITSMVRSPEMKFLGVGPGTGIVLKYGEHKGRIIV
PTYSTNWKSHLDGSQSSRVIYSDDHGLTWQMGAAVNDNRVTKSGQKIHSATMAIEKEQNT
ESVAVQLKNGDIKLFVRNKTGKLQVATSKDGGQTWQNDLDRYQAVNDVYVQLSAIALERD
GKEYIVLANANGPDRNNGYVRLAEVQADGSLKWLHHRLVQKGAFAYNSLQQIGKDDFALL
YEHKEAGQNDFTLSLKTFNWKFLTEDPVYDTVTVDGVEQLSDNQVAVHFTHAVFATNQPD
LTLANDQKMTFLFQKDAKTVIYHLDPKDFGQKITTASLADISNHFGLKVSLLAQLPHHKK
GM
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaacagtaaaaagctttttgaaaagcgccaacgtttttcaatccgtcgcctt
tctattggtgtaggatctgtattgattggtatttgtctttttggaacacccctagtctca
gcagaagaattgagaccaactcaacctggacttgtaaccagttctgttacagatttaagt
ccggcatctcatcaaaaggagagtgacatcacacaagtaaatgacctaaaggtctctgat
aaagcaattgttgaaacagagccaactctaagtgtaacagataatactattaggctagac
ttatctaatgatgacaagaaaagaaaggaaatcctatcagaaggccaattcgcctctgac
caagtgcaacaagctaatcctattgcagaggcttataaggaaaatgaagttttcaaaatt
gacaaccaggtccttcaaaagaactcaaaaattgatttaagtgaacacctggatgctttg
aaaaaacttgatagtgcaacgatttatgctgaaatcaaaacacctgaggacatggatgat
tttatgacttggttctctgtttcgacaagtgctaatgaaaatgaacgtttttacctttac
attacaaaagaaggtgttgtcggtgttgaaggggctgataatgctaacaagcctttttat
aaaagctttacttcagctagtcaacgcgttaaaccaagtgagtggaatgctttagctttt
gtgattaatcaagaagctcaaaaggttcaaatctatgttaatggcatcttgtctcaggag
gattcaacgtcaacacaatttatcaaggacttagcgaaccctgaatttgctcaaattgga
caaactcaacgaggtagaagcaataaatggggattttcacattttgatatcaaaaacttt
acggtatacaatagggcattgtcagaaacagaagtcggtgataggtcacaactttttatc
agaggaaaaaatcacgtgacattagcagaaggggcagaactttcagataaacaagacgtt
tatcaaagcggatatatcaaaagaaagaatcaagatggggtttatgcttaccgcatccca
gctctcttaaaaacagataaagggaccttgattgcgggtgctgacgaacgatttaatcat
tcctcagactggggtaatattggaatggttatcagacgcagtgaagacaatggtaaaacc
tggagtgacagaaacaccttagtcaacttgcgagataatccaaaagctgccgtagcagaa
gaaaattctcctgtgaatattgacatggtcttggtacaagatccaactagtaaacggatt
ttttctatttatgacatgttcccagaaggtagagggatttttggcatgtctaaaaaacaa
gaagtggaatataccaagcatggggataagacttatatgaacctttatcgcgaagatggt
aaaggtgatggggtttacaccattcgagagggtggctatgtctatactcctcaaggtgca
aaaaccaattacagggttattacagcatcagacaaaaaagaccgctctgatttaggagac
ctctaccaagatcaagaccttatcggcaatgtttatttcacaagtcataaaacgtcacca
tttagaatagcaaaatcaaactatttatggctgtcttatagcgatgatgatggcaaaact
tggtcatcaccaagagatattacttcaatggttagaagtccagaaatgaaatttttagga
gttggacctggaacaggaatcgtcttaaaatacggggaacacaaaggtcggattattgtt
ccaacctattcaacaaactggaaatcacatttagatggttctcaatcatctcgtgttatc
tactccgatgaccatggtctgacttggcagatgggagcagcagttaatgacaatcgtgtg
acaaaatctggtcagaaaattcattctgcaaccatggctattgaaaaggaacaaaacaca
gaatcagtagctgtccaattaaaaaatggggatattaaactgtttgttcgtaacaaaacc
ggaaaattacaggtggctaccagtaaagatggagggcaaacttggcaaaacgatttggac
cgttatcaagctgttaatgatgtctatgttcagttatcagccattgcacttgaacgagac
ggcaaggaatacatcgttttagccaatgctaatggaccggatagaaacaatggttatgtt
cgtttagcagaagttcaagcagatggaagtctcaaatggcttcatcatcgccttgttcaa
aaaggagcctttgcctataattcgttacaacaaattggaaaagatgattttgccctcctt
tatgaacataaagaagctggtcaaaacgactttaccttaagtctaaaaacctttaattgg
aaatttttaacagaggatcccgtttatgatacagttactgttgatggtgttgagcaatta
agtgataatcaggtggccgtgcactttactcatgctgtctttgctactaatcaaccagat
ttaaccttagcaaatgatcagaaaatgacttttctgtttcaaaaagatgctaaaacagtg
atttatcacttggatccaaaagattttggacaaaagatcacaactgcctcgcttgcggac
attagcaatcattttggtttaaaagtgtccttacttgctcaactgccacatcataaaaag
ggcatgtaa

DBGET integrated database retrieval system