KEGG   Streptococcus sp. I-P16: N597_06130Help
Entry
N597_06130        CDS       T02880                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sip  Streptococcus sp. I-P16
Pathway
sip00620  Pyruvate metabolism
sip00680  Methane metabolism
sip01100  Metabolic pathways
sip01120  Microbial metabolism in diverse environments
sip01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sip00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    N597_06130
  Energy metabolism
   00680 Methane metabolism
    N597_06130
Enzymes [BR:sip01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     N597_06130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Lysine_decarbox
Motif
Other DBs
NCBI-ProteinID: AGY38537
UniProt: U5P8R6
LinkDB All DBs
Position
complement(1205839..1208664)
Genome map
AA seq 941 aa AA seqDB search
MTLQKLESYTNKEIIKEEVEILTTILEDIAKNLVSPETFDKILELKKLSVSKDYLKLDQI
VRELSNEEMIVISRYFAILPLLINISEDVDLAFEINHQNNVGQDYLGKLSSTIRQVAETE
NAQEILERLNVVPVLTAHPTQVQRKTMLDLTTQIHSLLRQHRDVKAGLMNETKWYNNLRR
NIEIMMQTDMIREKKLKVTNEITNVMEYYNSSFLQAVPNLMLEYKRLAKEQGIELQQPKP
ITMGMWIGGDRDGNPFVTAETLKRSATIQSEVILNYYIQKISSLYRNFSLSTNLSKTSQA
VEEMAARSSDTSVFREKEPYRRAFHYIQSKLVQTLLNIKEWSVVGSTVDERHPIERLLGA
HTHQQGVVSDYIGTRISGAIQELAEDRPPYYETVEEFKQDLTLIQESLIENKAEALISGE
FAELLEAVEVFGFFLASIDMRQDSSVHEACVAELLKEAGINDHYSDLSEDEKCELLLQEL
LEDPRILSATHAEKSELLEKELAIFQTARELKDRLGEDVIRQTIISHATSVSDMLELAIM
LKEVGLIDKESARVQIVPLFETIEDLDQSEDTMRKYLSLPIAKRWIASKNNYQEIMLGYS
DSNKDGGYLSSCWTLYKAQQQLTAIGDEFGVKITFFHGRGGTVGRGGGPTYEAITSQPLR
SINDRIRLTEQGEVIGNKYGNKDAAYYNLEMLVSATINRMIAKKKSEKSMSDQYNEIMDQ
IVNRSYDIYRELVFGNEHFYDYFFESSPIKAISSFNIGSRPAARKTIKEIGGLRAIPWVF
SWSQSRVMFPGWYGVGSSFKEFIDADPENIETLRYMYQKWPFFKSLLSNVDMVLSKANMN
IAFEYAKLCEEEEVRDIFNIILDEWQLTKDVILQIEGHDELLAENPYLKDSLDYRMPYFN
VLNYIQLELIKRQRRGELPADQDKLIHITINGVATGLRNSG
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atgactttacaaaaactagagagctataccaacaaagagattatcaaagaagaagttgag
attttaaccactattttagaagacattgctaaaaatttggtgagtccagaaacctttgat
aagattcttgaattgaaaaaactatctgtctcaaaagactatttaaaattggatcaaatt
gttagagagctatcaaatgaagagatgatcgtgatttctcgatactttgccattctcccc
ttattgattaatatctctgaagatgtcgatttggcttttgaaatcaatcatcagaataat
gtgggacaggactatctaggaaaactatcgtcaaccatccgccaggtggctgagactgaa
aatgctcaggaaattttggaacgcctcaacgtggtaccagtattgacagctcatcctacc
caagtgcaacggaaaaccatgttggacctaaccactcagattcacagccttttgcgccaa
catcgggatgtgaaagcaggcttgatgaacgagaccaaatggtacaataatttgcgtcga
aacattgaaattatgatgcaaaccgatatgatccgtgaaaagaaactcaaggtaacaaat
gagattaccaatgtcatggaatactataatagttccttccttcaggctgttcctaactta
atgttggaatacaaacgtcttgccaaggagcaagggatcgagttacagcaacctaaaccg
attacgatgggaatgtggattggtggagaccgggatgggaatccttttgtaactgctgag
accttgaagcgatcagctaccattcaaagtgaagttattctaaactactatattcagaaa
atatctagcctatatcggaatttctccctttctaccaatctttcaaaaaccagtcaagcg
gttgaagagatggcggcccgttcgagtgatacctctgtctttagagagaaggaaccctac
cgtcgagccttccattatattcaatccaaattggtccaaaccttattgaatattaaggaa
tggtcagtagttggctcaacagtagatgagcgccatccgattgaacgtcttctcggtgct
cacacccatcaacaaggagtggtttccgattatatcggtacccgtatcagtggtgctatc
caagagttggcagaagatcgtcctccttattacgaaacagttgaagaatttaaacaggat
ttgaccctgattcaagaatcattgattgaaaataaggcagaggctttaatctcaggtgag
tttgctgagttattagaagcagtagaggtctttggtttcttcttggcttcgattgacatg
cgtcaagattcgagtgttcatgaagcctgtgtggcagaactattaaaagaagcagggatt
aatgatcactacagtgatttgtcagaagacgaaaagtgcgagttgctgttacaagagttg
ttagaagatcctcggattttatctgctacccatgcagaaaaatcagaattgcttgagaaa
gaattagctattttccaaacagcgcgtgaattaaaagaccgcttaggagaagatgtcatt
cgtcaaaccattatttctcatgcaaccagtgtatcggatatgcttgagttggccatcatg
ttgaaagaagtgggactgattgacaaggaaagcgcacgtgtgcaaattgttcctctcttt
gagacgatcgaagacttggaccaatctgaagatacgatgagaaagtatctgtcacttcca
attgctaaacgctggattgcttctaagaacaactaccaagaaattatgcttggatactca
gatagtaataaagacggtggttatctatcttcttgttggactctttataaggcccaacaa
caattaacagcgattggcgacgaatttggtgtcaagatcaccttcttccatggccgtggt
ggaacggttggtcgtggtggtggcccaacctatgaagctatcacctcacaaccattgaga
tccatcaatgatcgaattcgtttgactgagcaaggtgaggtcattggcaacaaatatggg
aataaggatgcagcttattacaacttagaaatgttggtctctgcaacgattaaccggatg
attgctaagaagaagagtgaaaagagcatgtccgaccagtacaatgagattatggatcag
attgtcaatcgtagctacgatatttatcgtgaactggtttttggcaatgaacatttctat
gattacttcttcgaatccagtccaattaaggccatttctagtttcaatattggttcgcgt
ccagcagcccgtaagaccatcaaagaaatcggtggcttgcgtgccattccttgggtcttc
tcatggtcacagagccgcgtgatgttccctggctggtacggtgtagggtccagttttaaa
gaatttattgatgcagaccctgaaaacattgaaaccttgcgttatatgtaccaaaaatgg
ccattcttcaagtctcttctttcaaacgtagatatggtgctctcaaaagccaatatgaac
atcgcatttgaatatgccaagctgtgtgaagaagaggaagttcgtgatatcttcaatatt
atcctggacgaatggcaactgaccaaggatgttattttacaaattgaagggcatgatgaa
ctattagctgaaaacccttatctaaaagatagtttagattatcgtatgccatactttaat
gttctgaactatattcaattagaattaattaaacgccaaagacgtggtgaattgcctgca
gatcaggacaagttgattcatatcaccatcaatggtgtcgcgacaggattgcgtaattct
ggttaa

DBGET integrated database retrieval system