KEGG   Streptococcus iniae ISET0901: DQ08_06210Help
Entry
DQ08_06210        CDS       T03285                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
siq  Streptococcus iniae ISET0901
Brite
Translation factors [BR:siq03012]
 Eukaryotic Type
  Elongation factors
   DQ08_06210 (tuf)
 Prokaryotic Type
   DQ08_06210 (tuf)
Mitochondrial biogenesis [BR:siq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    DQ08_06210 (tuf)
Exosome [BR:siq04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DQ08_06210 (tuf)
  Exosomal proteins of breast cancer cells
   DQ08_06210 (tuf)
  Exosomal proteins of colorectal cancer cells
   DQ08_06210 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase GrpE
Motif
Other DBs
NCBI-ProteinID: AHY16051
UniProt: A0A1J0MZL2
LinkDB All DBs
Position
complement(1254182..1255378)
Genome map
AA seq 398 aa AA seqDB search
MAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPTSVNQPKDYASIDAAPEER
ERGITINTAHVEYETETRHYAHIDAPGHADYVKNMITGAAQMDGAILVVASTDGPMPQTR
EHILLSRQVGVKHLIVFMNKIDLVDDEELLELVEMEIRDLLSEYDFPGDDLPVIQGSALK
ALEGDEKYEDIVMELMATVDSYIPEPERDTDKPLLLPVEDVFSITGRGTVASGRIDRGTV
RVNDEIEIVGIKEETQKAIVTGVEMFRKQLDEGLAGDNVGILLRGVQRDEIERGQVIAKP
GSINPHTKFKGEVYILSKEEGGRHTPFFNNYRPQFYFRTTDVTGSIELPAGTEMVMPGDN
VTINVELIHPIAVEQGTTFSIREGGRTVGSGIVSEIEA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaaatacgatcgtagtaaaccccacgttaacattggtacaatcggacac
gttgaccatggtaaaacaactttaacagctgcaattacaactgttcttgcacgtcgttta
cctacttcagttaaccaacctaaagattatgcttctatcgatgctgctccagaagagcgc
gaacgcggaatcacaatcaacactgcacacgttgagtacgaaactgaaactcgtcactat
gcccacatcgatgccccaggacacgcggactatgttaaaaacatgatcactggtgctgcc
caaatggacggagctatccttgttgttgcatcaactgatggaccaatgccacaaactcgt
gagcacatccttctttcacgtcaagttggtgttaaacaccttatcgttttcatgaacaaa
attgaccttgttgatgatgaagaattgcttgaattagttgaaatggaaatccgtgatctt
ctttcagaatacgatttcccaggtgatgaccttccagttatccaaggttcagctcttaaa
gctcttgaaggcgatgaaaaatacgaagacatcgttatggaattgatggctactgttgat
tcatacattccagaaccagaacgtgatactgacaaaccattgcttcttccagttgaggat
gtattctcaatcactggacgtggtactgttgcttcaggacgtatcgaccgtggtactgtt
cgtgtcaacgacgaaatcgaaatcgttggtattaaagaagaaactcaaaaagctatcgtt
actggtgttgaaatgttccgtaaacaacttgacgaaggtcttgcaggagacaacgtaggt
atccttcttcgtggtgttcaacgtgacgaaatcgaacgtggacaagttattgctaaacca
ggttcaatcaacccacatactaaatttaaaggtgaagtatacatcctttctaaagaagaa
ggtggacgtcatactccattcttcaacaactaccgcccacaattctacttccgtacaact
gacgtaacaggttcaatcgaacttccagcaggtacagaaatggttatgcctggtgataac
gtgacaatcaacgttgagttgatccacccaatcgccgtagaacaaggtactactttctca
atccgtgaaggtggacgtactgttggttcaggtatcgtttcagaaatcgaagcttaa

DBGET integrated database retrieval system