KEGG   Streptococcus iniae ISET0901: DQ08_08445Help
Entry
DQ08_08445        CDS       T03285                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
siq  Streptococcus iniae ISET0901
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:siq00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    DQ08_08445
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    DQ08_08445
Enzymes [BR:siq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     DQ08_08445
Peptidoglycan biosynthesis and degradation proteins [BR:siq01011]
 Precursor biosynthesis
  Racemase
   DQ08_08445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1688814..1689920)
Genome map
AA seq 368 aa AA seqDB search
MISSLHRPTLATVHLEAIRGNLKAVQTHIPQGTKTYAVVKANAYGHGAVAVAKAIEQRVD
AYCVSNLDEAIELREAGIAKEILILGIILADQLALAISYNLVVTAASLEWLDCLRDQAVD
VRGLHVHVKVDSGMGRIGVRTLTEANQLIAGLKELGASVDGIFTHFATADEAKTDKFNQQ
LAFFTDLVDALNDKPALVHASNSATSLWHSDSIFNAVRLGIVIYGLNPSGRDLALPYPLT
AALSLESALVHVKCIEAGATVGYGATYEALETQFVGTIPIGYADGWTRDMQNFKVLIDGQ
FCPVIGRVSMDQLTVRLPKTYPIGTKVTLIGRNGKHEITATEVAEKRGTINYEVTCLLSD
RVPRLYRD
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaagtttgcatagaccaactctagcgacagttcatttagaggcaattagaggt
aatttaaaggctgttcaaacacatattcctcaggggacaaaaacctatgcagttgttaag
gcaaatgcttatggtcacggggctgtagctgttgctaaagctattgagcagcgagtggat
gcttactgtgtttccaatcttgatgaggcaattgagttgcgtgaggctggcattgctaaa
gaaatcttgattttaggtattattttagctgatcagcttgctttagcaattagctataac
cttgtcgtgacagcagctagtttagagtggctagattgtcttagagatcaggcggttgat
gttagggggctacatgttcatgttaaggttgattctggtatggggcgcattggtgtgcgt
accctgacagaagctaatcaattaattgctggtttgaaggagcttggtgcgtcagtggat
ggtatctttactcattttgccactgctgatgaagcaaagactgataaattcaatcaacag
ttggctttctttacagatttggttgatgctttgaatgacaaaccagctttggttcatgct
agcaattccgcaactagtctttggcatagcgacagcattttcaacgctgttcgtttagga
attgtgatctatggtctcaacccgagtggacgtgatttggctctgccttatcctttgacc
gcggctctttctttggagtcggctttggttcatgttaagtgcattgaggcaggggctacg
gttggttatggagctacttatgaagctttggagacacaatttgttggtactattcccatt
ggctatgctgatggatggacaagggatatgcaaaactttaaggtgttgattgatgggcaa
ttttgtccagttattggccgtgtgtcgatggatcaattgaccgttagactgcctaaaact
tatccaattggtacgaaggtaaccctaattggcagaaatgggaagcatgagattacagct
actgaggttgctgaaaaacgtgggaccattaattatgaggtaacctgtttattgagtgat
cgtgttccaaggctttatcgggattaa

DBGET integrated database retrieval system