KEGG   Ruegeria sp. TM1040: TM1040_3262Help
Entry
TM1040_3262       CDS       T00359                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sit  Ruegeria sp. TM1040
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sit00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TM1040_3262
   00650 Butanoate metabolism
    TM1040_3262
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TM1040_3262
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TM1040_3262
Enzymes [BR:sit01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     TM1040_3262
Amino acid related enzymes [BR:sit01007]
 Aminotransferase (transaminase)
  Class III
   TM1040_3262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
RoseoBase: 
UniProt: 
LinkDB All DBs
Position
mega:262509..263786
Genome map
AA seq 425 aa AA seqDB search
MLNAEISIRRNAAISRGVGMQTQVYVSRAEGAEVWDVEGHRYIDFAAGIAVVNTGHCHPK
VMEAVRSQSAAFTHTCHQVLPYESYIRLAERLNDKVPGNFDKKTAFVTTGAEAVENAIKI
ARAATGRSAILAFGGGFHGRTFMGMSLTGKVAPYKKGFGAMMPDVYHVPFPVDLHGISTA
DALGAIDRLFKADLDPDRLAAIILEPVQGEGGFYPAPKELMHALRELCDAHGILLIADEI
QTGFARTGHLFAMEGYDVAPDLTTMAKGLAGGLPLAAVTGRAEVMDAAAPGGLGGTYGGN
PLGIAAAHAVLDVIEEEDLCTRANALGARLKQRLSAIQERVPEIADIRGPGFMVAAEFNT
TDGSAPNPEMANAIRTEALERGLVLLTCGVYGNVIRFLAPITIPDAVFSEALEILEASIL
AAKDA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatgccgaaatctccatccgccgcaacgctgccatatcccggggagtcggcatg
caaacgcaggtctatgtctcccgcgcagaaggggccgaagtctgggacgtcgaagggcac
cgctacattgattttgcagccggaatcgcggtggtgaacacgggccactgtcaccccaag
gtgatggaggccgtgcgcagccagagcgcggcgttcacccatacctgccatcaggttctg
ccctatgaatcctacattcgtctcgccgagcgactgaatgacaaggtcccgggtaacttt
gataaaaagaccgccttcgtcacgaccggggccgaagcggtggagaatgccatcaagatc
gcccgcgccgcgacgggccgttccgccatcctcgcgtttggaggcgggtttcacgggcgc
accttcatgggaatgagcctcaccggcaaggtggccccgtacaaaaagggctttggcgcg
atgatgcccgatgtgtatcacgtcccctttcccgttgatctgcatgggatttcgacggcg
gatgcgctgggggcgattgatagactcttcaaggcggacctcgatcctgatcgccttgct
gccatcattctggagcccgttcagggcgaaggcgggttctaccccgcccccaaagaacta
atgcacgcgctgcgcgagctctgcgatgcccatgggatcttgctcattgcggatgagatc
caaaccggatttgcccgcacgggacatctctttgcgatggaaggctatgatgttgcgccc
gacctcaccacgatggccaaagggctggccggagggttgccgctggcggctgtcaccggg
cgggccgaagtcatggatgccgcagcaccgggcggccttggcggcacctatggtggcaac
ccgctcggcattgccgccgcgcatgcggtgttggatgttatcgaagaagaagacctctgc
acccgcgccaacgcgcttggggcgcggctcaaacagcgcctgagcgctattcaggagcgc
gtgcccgagattgccgacatccgtggtcccggtttcatggtggctgcagagttcaacacc
accgatggctcagcacccaacccggagatggcaaacgccatccgcaccgaggcgcttgag
cggggattggtgctgctgacctgtggagtctacggcaatgtgatccgttttctcgccccg
atcacgataccggatgcggtgttttccgaggctctcgagatcctcgaggcctccatcctg
gctgcaaaggacgcctga

DBGET integrated database retrieval system