KEGG   Shewanella japonica: SJ2017_1962Help
Entry
SJ2017_1962       CDS       T04959                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
sja  Shewanella japonica
Brite
Enzymes [BR:sja01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     SJ2017_1962
Peptidases [BR:sja01002]
 Metallo Peptidases
  Family M2
   SJ2017_1962
Exosome [BR:sja04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SJ2017_1962
CD molecules [BR:sja04090]
 Proteins
  SJ2017_1962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2346049..2347911)
Genome map
AA seq 620 aa AA seqDB search
MNQPFKQPSKIAIVISVVLGLTACQQAEEEIITSTVKVTQQSASISTESAIAFINEAEAE
LAQLSVEGARTEWVYSNFITEDTAAMSAAIGEKLTSRSVYFATEAAKYADVKLDPINARK
LHILRSSLVLPAPLDPAKNAELAQISSELNGLYGKGKYCFADGRCMTQPELSALMADSKD
PAILLEAWQGWREIAKPMRPLFKREVELANEGARDLGFTDLSELWRSQYDMKPDDFSNEL
DRLWGDIKPLYDSLHCYVRGELNEQYGDTIVPNQGPIPAHLLGNMWAQQWGTIYDSVAPQ
DADPGYDVTALLEENQYDEIKMVKQAEGFFSSLGFSPLPDTFWTRSLFVQPKDRDVVCHA
SAWDLDNEDDIRIKMCIQKTAEDFTVIHHELGHNYYQRAYKNQPHLFKGSANDGFHEAIG
DTIALSITPSYLKQIGLLEQVPDESKDIGLLLKQALDKIAFMPFGLMIDQWRWKVFNGEI
SPEQYNQAWWDLREKYQGVAAPIARTEADFDPGAKYHVPGNVPYTRYFLAHVLQFQFHQS
LCEIAGNEGPVHRCSIYGNKDAGHKLNEMLEAGLSQPWPEALNIVTGTKAMDANAVLDYF
APLHVWLDKQNQSKSRQCGW
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagccttttaaacagccgtctaaaattgcaatcgtcatttcagtcgtattggga
ttaacagcatgccagcaagctgaagaagaaatcattacatcaaccgtaaaagtcactcaa
caatcagcaagtatttcaacggaatctgctattgcatttataaatgaagcagaagctgaa
ttagctcaattatccgttgaaggtgctcgaaccgaatgggtttacagtaattttattact
gaagatactgcagcgatgtcggcagcgattggtgaaaagctgacatcacgatcagtatac
tttgctacagaagcagctaagtatgccgatgtaaaacttgatccaatcaatgcgcgtaaa
cttcacatccttcgcagtagcttagtactaccagccccattagatcctgctaaaaatgca
gagcttgcgcaaattagttcagaattaaatggcttatatggtaaaggtaaatattgtttc
gctgatggtcgttgcatgactcagccagagctgtcagcgttgatggcagactctaaagat
cctgcaattttattagaagcatggcaaggctggcgtgaaattgccaaaccaatgcgacct
ttattcaaacgcgaggttgagctcgctaatgaaggcgcacgcgatctcggctttacagac
ctctcagagctttggcgtagccaatatgatatgaaacctgatgatttttcaaatgaacta
gataggttatggggagatattaaaccactttatgattcactacattgttatgtacgtggt
gagttaaacgaacaatatggcgatactattgtaccaaatcaaggccctatcccagcgcat
ttattaggtaatatgtgggctcagcaatggggcacaatatatgattctgttgcgccgcaa
gatgcagatccaggctatgatgtcaccgcattgctagaagagaatcaatatgatgaaatt
aagatggtcaaacaagctgaaggcttcttttcttcactaggttttagtccattgcctgat
actttctggactcggtcgttgtttgttcaaccaaaagaccgtgatgtcgtttgccacgct
tctgcttgggatttagataacgaagatgatatccgcattaaaatgtgtattcaaaaaaca
gcggaagactttacagtcattcaccatgaactgggtcataactattatcaacgtgcctac
aaaaaccaaccacatttgtttaaaggctctgctaatgatggctttcatgaagcaattggt
gacactatcgccctctccattacacccagttatttaaaacaaattggcttactagaacaa
gtacctgacgaatcgaaagatataggtttattactcaaacaagcattagacaaaatcgct
ttcatgccttttggtttaatgattgatcaatggcgctggaaagtgttcaacggtgagatt
tcaccagagcaatataaccaagcatggtgggatctgcgtgaaaagtaccaaggtgtagca
gcaccaatagcacgaactgaggctgactttgaccctggcgccaaatatcatgtacctggt
aatgtgccatatacacgttattttttagctcacgtattacagttccaattccatcaatca
ttatgtgaaatagcgggtaacgaaggaccagttcaccgttgtagtatttacggtaataaa
gatgcgggtcataagttaaatgaaatgctagaagctggattaagccaaccttggcctgaa
gcacttaatatagtgactggcactaaagcaatggatgcaaacgcagttttagattatttt
gcgcctttacatgtatggctcgacaaacaaaaccaatctaaaagccgtcaatgtggctgg
taa

DBGET integrated database retrieval system