Scomber japonicus (chub mackerel): 128371343 Help Entry 128371343         CDS       T09718                                  Symbol hmgb1a Name (RefSeq) high mobility group protein B1a   KO K10802   high mobility group protein B1 Organism sjo  Scomber japonicus (chub mackerel) Pathway sjo03410   Base excision repair sjo04140   Autophagy - animal sjo04217   Necroptosis Brite KEGG Orthology (KO) [BR:sjo00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     128371343 (hmgb1a)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     128371343 (hmgb1a)   09143 Cell growth and death    04217 Necroptosis     128371343 (hmgb1a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sjo03036]     128371343 (hmgb1a)    03400 DNA repair and recombination proteins [BR:sjo03400]     128371343 (hmgb1a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sjo04147]     128371343 (hmgb1a) Chromosome and associated proteins [BR:sjo03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     128371343 (hmgb1a) DNA repair and recombination proteins [BR:sjo03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      128371343 (hmgb1a)    MMR (mismatch excision repair)     Other MMR factors      128371343 (hmgb1a) Exosome [BR:sjo04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    128371343 (hmgb1a) BRITE hierarchy Motif Pfam:  HMG_box HMG_box_2 HMG_box_5 Motif Other DBs NCBI-GeneID:  128371343 NCBI-ProteinID:  XP_053187621 LinkDB All DBs Position 13:19390914..19394935 Genome browser AA seq 207 aa AA seqDB search MGKDPTKPRGKMSSYAYFVQTCREEHKKKHPEASVNFAEFSKKCSERWKTMSAKEKGKFE DLARQDKARYEREMMSYVPVRGGKKKKFKDPNAPKRPPSAFFIFCSEFRPKVKGESPGLS IGDVAKRLGEMWNGTASEDKQPYEKKAAKLKEKYEKDIAAYRAKGKPGAAAPAKAPAKAV EKKDDDDDDDDEDDEEEEEDDDDDDDE NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggggaaagatccaactaagccgaggggcaagatgtcgtcctatgcctattttgtccag acctgtcgggaggagcacaagaagaaacaccccgaggcttcggttaactttgcagagttc tccaagaagtgctctgagcgatggaagacaatgtctgccaaggagaagggcaaatttgag gacctcgccaggcaggacaaggcgcgttatgagagggagatgatgagctacgttccagtc aggggaggaaagaagaagaagttcaaggaccccaatgcccccaagagacccccatctgcc ttcttcatcttctgctcagagttccgccctaaggtgaaaggggagagccctggtctgtcc attggagatgttgccaagaggctgggcgagatgtggaacggcacagcttcagaggacaag cagccctatgagaaaaaggcagctaaactgaaggagaagtacgagaaggacatcgcagca tatcgcgctaagggcaaaccaggcgccgcagcacccgcaaaagccccggccaaggcagtg gagaagaaggatgatgacgatgatgatgatgatgaggatgacgaggaggaggaggaagac gatgatgacgatgatgacgagtaa

DBGET integrated database retrieval system