Scomber japonicus (chub mackerel): 128373940 Help Entry 128373940         CDS       T09718                                  Name (RefSeq) glutathione S-transferase A-like   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism sjo  Scomber japonicus (chub mackerel) Pathway sjo00480   Glutathione metabolism sjo00980   Metabolism of xenobiotics by cytochrome P450 sjo00982   Drug metabolism - cytochrome P450 sjo00983   Drug metabolism - other enzymes sjo01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:sjo00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     128373940   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     128373940    00982 Drug metabolism - cytochrome P450     128373940    00983 Drug metabolism - other enzymes     128373940  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:sjo02000]     128373940 Enzymes [BR:sjo01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      128373940 Transporters [BR:sjo02000]  Other transporters   Pores ion channels [TC:1]    128373940 BRITE hierarchy Motif Pfam:  GST_N_3 GST_N_2 GST_N FH2 Motif Other DBs NCBI-GeneID:  128373940 NCBI-ProteinID:  XP_053190117 LinkDB All DBs Position 15:complement(22123728..22126752) Genome browser AA seq 169 aa AA seqDB search MAKSMSLLLGDGSPPCQQVMIALEEKKLQGYKHKVLSFEKGEHTFQEVLEINPRGHLPAF KHGDNIVNESSAACLYLEPGVDFDQLQENLCQMERRCKASWDHLKVIAKHEMKPQLKQKM SDFLKDCICWLLVGRYPKLARYYSLLKDRPSIKSAGRHTHCPAHRIMMS NT seq 510 nt NT seq  +upstreamnt  +downstreamnt atggccaaatctatgagtctcctgttgggggatggatcccctccctgccagcaagttatg atcgctctggaggaaaagaagctgcagggttacaaacacaaggtgctgtcctttgagaaa ggagagcacacatttcaggaagtcttggaaatcaacccaagaggacatctccctgccttc aaacatggagacaacatagtgaatgagtccagtgctgcatgtttatacctggagcctgga gtggatttcgaccagctgcaggagaacctgtgtcagatggagcggcgttgcaaagcttca tgggatcatctaaaggtgatcgccaagcatgagatgaagccccagctgaaacagaagatg tctgacttcctcaaagactgcatctgctggctattggttggacgctaccccaaactggcc agatactacagcctgttgaaggacagacccagcatcaagtcagctggccgccacactcac tgcccggcccacagaattatgatgtcctga

DBGET integrated database retrieval system