KEGG   Sanguibacter keddieii: Sked_15670Help
Entry
Sked_15670        CDS       T01214                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ske  Sanguibacter keddieii
Brite
Enzymes [BR:ske01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Sked_15670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACZ21502
UniProt: D1BFZ1
LinkDB All DBs
Position
complement(1751643..1752266)
Genome map
AA seq 207 aa AA seqDB search
MAVYTLPELGYDYGALEPHISGRIMELHHSKHHQAYVTGANTALEKLADARESGDLAAVN
LHEKNLAFNLGGHINHSAFWTNLSPEGGGEPTGDLAETIGTDFGSFEAFKKHFAAVAAGV
QGSGWAILAWDSIGQKLIIVQLYDQQGNIPMGLTPIVLLDVWEHAYYLDYQNVRADYVTA
WWNLVSWDDAAARLARAKTQTSGLIVP
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctgtctacacccttcccgagctcggctacgactacggtgcgctcgagccgcacatc
tctggtcgcatcatggagctccaccactccaagcaccaccaggcctacgtgaccggcgcc
aacaccgcgctcgagaagctcgccgacgctcgcgagagcggcgacctcgccgcggtcaac
ctccacgagaagaacctcgcgttcaacctcggtggccacatcaaccactcggcgttctgg
accaacctctcccccgagggcggcggcgagcccaccggcgacctggccgagaccatcggc
accgacttcgggtccttcgaggccttcaagaagcacttcgcggccgtcgccgccggcgtg
cagggctccggctgggccatcctcgcctgggactccatcggccagaagctcatcatcgtc
cagctgtacgaccagcagggcaacatccccatgggcctcaccccgatcgtcctcctggac
gtctgggagcacgcctactacctcgactaccagaacgtccgtgccgactacgtcacggcc
tggtggaacctggtgagctgggacgacgccgcggcacgcctcgcgcgcgccaagacgcag
acctcgggtctcatcgtcccctga

DBGET integrated database retrieval system