KEGG   Saccoglossus kowalevskii (acorn worm): 100367150Help
Entry
100367150         CDS       T04123                                 

Definition
(RefSeq) sialidase-4-like
  KO
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
sko  Saccoglossus kowalevskii (acorn worm)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sko00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100367150
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100367150
Enzymes [BR:sko01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     100367150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 410 aa AA seqDB search
MNWKTENFNCASYRIPAIVYNKGVFLAFCEARRTSFRDYGEMDLVLRRGILLEKQVEWEG
IQVIASMRGERTMNPVPIVDNVNKAVVVVFNTFPSNVTETDLLKEGVFNQTVFVMKSTDN
GITWSDPQDITDTTLGKVEPAWTIFSPGPGHGIQLSSGRLIVPGNYYVKDPVEPGIWPQI
KTAVLEFFDVLYGAVGTSNVFYSDDGGSSWHVGGSVPTANAGELETGKTIHANESQVTEL
DDGVICINCRTLGVEMPRVQAFSKDDGMTFTVAQVVDKLVEPGYTGSFMPSTKNFGGCQG
SILGFPAPEGVPDGFSKTWALFSNPADKENRINLSVRLSIDGCKTWSAPWSLCPGPSAYS
DLTYFEMDDGNGGINKLFACLYECGTTDFPYEKIVFQMFTLESVLEGTKH
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaattggaaaactgaaaattttaattgtgcaagttaccgaattcctgcaattgtgtat
aataaaggtgtgttcctggcattttgtgaagctcggaggacttcattccgggactatggt
gaaatggaccttgtcctaagaagaggtattctactagagaaacaggtggaatgggagggc
atccaagtaatcgccagtatgcgtggtgaaagaacaatgaatcctgttcccatagtggac
aatgtaaacaaggctgtagtggttgtcttcaatacgttcccatccaatgtcacagagacg
gatcttttgaaagaaggtgttttcaatcagacagtatttgtcatgaaaagtacagacaat
ggtataacgtggagtgatccacaagatatcacggatacaacattaggaaaagttgagcct
gcatggactatattttcacctggcccaggtcacggtatccagttgtcctctggtcgcctt
atagttcccggaaattattatgtaaaagacccagttgaacctggaatttggccgcaaata
aaaacagcagttttggaattctttgacgttctctatggtgctgtgggtacttccaatgtg
ttctatagtgatgatgggggctcctcatggcatgttgggggcagtgttcccacggccaat
gcgggtgaactggaaacaggaaaaacaattcatgctaacgagtcgcaggtaacagagctt
gatgatggtgtaatatgcataaactgtcgtacattaggtgttgagatgccacgtgtacaa
gccttcagtaaagatgatggtatgacatttacagtagcccaagttgtggataaattagtt
gagccaggatatactggtagttttatgccgagtactaaaaactttggtggctgccaggga
agtatcctaggattcccggcaccagaaggagttccagatgggttttcaaaaacctgggca
ttgttctccaatccggcagataaagaaaacagaatcaatttatccgtacgtcttagcata
gatggatgtaaaacgtggagcgctccatggtcattgtgtcctggacccagtgcatactca
gatctaacatacttcgaaatggatgatggaaatggcggaataaataaattgtttgcttgt
ctttatgagtgtggcacaacagactttccttacgaaaagattgtttttcagatgtttaca
ttagagtctgtactggagggaacaaagcactga

DBGET integrated database retrieval system