Saccoglossus kowalevskii (acorn worm): 100370429 Help Entry 100370429         CDS       T04123                                  Name (RefSeq) histone H3-like   KO K11253   histone H3 Organism sko  Saccoglossus kowalevskii (acorn worm) Brite KEGG Orthology (KO) [BR:sko00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sko03036]     100370429   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sko04147]     100370429 Chromosome and associated proteins [BR:sko03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100370429 Exosome [BR:sko04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100370429 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone PAF YebU_pre-PUA_dom Motif Other DBs NCBI-GeneID:  100370429 NCBI-ProteinID:  XP_002739194 LinkDB All DBs Position Un AA seq 110 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNL NT seq 329 nt NT seq  +upstreamnt  +downstreamnt atggcacgtaccaagcaaacagcacgtaaatctactggtggaaaagcgccacgaaaacaa ttggcaacaaaggctgctcgcaagagcgcacctgctactggcggagtgaagaaaccacat cgttacaggcctggcaccgtcgctcttcgtgagatccgccgttaccagaaaagtacagag ctcctgatccgaaagctgccattccagcgtctggttcgagaaattgcgcaagatttcaag accgaccttcgattccagagctccgccgtgatggccctacaagaagccagcgaggcatac ctagtaggtcttttcgaagacaccaacct

DBGET integrated database retrieval system