KEGG   Streptomyces lydicus: SL103_02425Help
Entry
SL103_02425       CDS       T04699                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
slc  Streptomyces lydicus
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:slc00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SL103_02425
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SL103_02425
Enzymes [BR:slc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     SL103_02425
Peptidoglycan biosynthesis and degradation proteins [BR:slc01011]
 Precursor biosynthesis
  Racemase
   SL103_02425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
526757..527962
Genome map
AA seq 401 aa AA seqDB search
MNETAKRARAVIDLAAVRSNVRTLRDRAPRAELMAVVKSDGYGHGAVRCARAAREAGATW
LGTALPEEAFALRAAGDTGRLMCWLWTPGGPWRQAVEQDIDVSVSGLWALREVVAAARAC
GRTARVQLKIDTGLGRNGCQPADWPELTAAARAAEAEGALTVTGVWSHFACADEPGHPSI
DAQLASFEDALRTAGAAGLRPEVRHIANTPATLTLPHAHYDLVRAGIGIYGISPSPELGT
SQDLGLRPAMTLEAALASVKRVPGGHGVSYGHLYTTPGETTLALVPLGYADGVPRHASGT
GPVLVAGKWRTVAGRIAMDQFVVDLGGDSAEEGATAVLFGPGDRGEPTAEDWARAAGTIG
YEIVTRIGTRVPRVYVGSGIRSGAEEAAAAEGDSAFTGGTA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagacagcgaagcgcgcccgtgccgtgatcgacctcgccgccgtgcggtcgaac
gtccgcacgctgcgcgaccgtgcgccccgggcagagctgatggccgtggtcaagtccgac
ggctacggacacggtgcggtgcgctgcgcgcgcgccgcccgtgaggccggggcgacctgg
ctgggcaccgcgctgcccgaggaggcgttcgcgctgcgcgcggccggcgacaccgggcgg
ctgatgtgctggctgtggacgccgggcgggccctggcgccaggccgtcgagcaggacatc
gacgtctcggtgagcgggctgtgggcgttgcgcgaggtggtcgcggcggcccgcgcctgc
ggccgtaccgcccgcgtccaactcaagatcgacaccggtctcggccgcaacggctgccag
cccgccgactggccggagctgaccgccgccgcccgcgccgccgaggccgagggcgcgctc
accgtcaccggcgtctggtcgcacttcgcctgcgccgacgagccggggcacccctcgatc
gacgcccagctcgcctccttcgaggacgcgctgcggaccgccggggcggccggactgcgc
cccgaggtgcggcacatcgccaacaccccggccaccctcaccctgccgcacgcccactac
gacctggtgcgggccggcatcggcatctacggcatctcgcccagccccgagctcggcacg
tcccaggacctcgggctgcggcccgcgatgaccctggaggccgcgctcgcgtcggtcaag
cgggtcccgggcggccacggggtgtcgtacgggcacctgtacaccacgcccggcgagacc
accctcgcgctggtcccgctcggctacgccgacggcgtcccgcggcacgcctccggcacc
gggccggtgctggtcgccggcaagtggcggacggtcgccggacggatcgcgatggaccag
ttcgtggtcgacctgggcggcgacagcgccgaggagggcgcgacggcggtgctgttcggc
cccggtgaccgcggcgagccgaccgcggaggactgggcccgggcggccggaaccatcggc
tacgaaatcgtcacccggatcggaacccgggtgccacgcgtctatgtgggcagtggcata
cggagcggggcggaagaagccgcagcagccgagggcgacagcgcgttcacggggggtacc
gcatga

DBGET integrated database retrieval system