KEGG   Streptomyces lydicus: SL103_13095Help
Entry
SL103_13095       CDS       T04699                                 

Definition
(GenBank) neuramidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
slc  Streptomyces lydicus
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:slc00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SL103_13095
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SL103_13095
Enzymes [BR:slc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SL103_13095
Bacterial toxins [BR:slc02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SL103_13095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3046673..3047881)
Genome map
AA seq 402 aa AA seqDB search
MTAVRPRTLAALIGAGLGLWSVLPVPAAAPRPAAHRAAGRSALFESTDLAVSGQGAHTYR
IPALATLPDGTLLAAYDRRNDSAADLPGNVDVMVRRSTDKGRTWSAPRAAVDYDGGVGAG
DPSLLVDRTTGRVFLFHAYAPRGVGFRSAGAGNAPDSTGVLHTDYSRSDDGGRHWHHRRL
TRVLKDPSWRGIFASSGAGSQLAGGRLLQQYAFRKADGSMWAAGAYSDDHGASWHLGRPV
GPRMDENKTVELADGRVLLNSRTGSVRRRLVAHSRDGGLTYSAPAVDDALIDPGNNASLL
RYDPTAPARLPRAHWLLFSNTASTRARENLTVRVSCDDGVTWPLARTVTPGAAAYSTLTR
LTDGTFGLLYESGPYRKLTFARFDGGWLGVRACPAGRGPARP
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtgacggccgtccgcccccgcacactggccgcgctgatcggcgccggcctcggtctgtgg
tccgtcctgccggtgccggcggccgcgccgcgcccggcggcacaccgcgccgccgggcgg
tcggccctgttcgagagcaccgatctggcggtgtcggggcagggcgcgcacacctaccgc
atcccggcgctggcgacgctgccggacggcaccctcctcgcggcctacgaccggcgcaac
gacagcgccgccgatctgccggggaacgtggacgtgatggtgcggcggagcaccgacaag
gggcgtacctggagtgccccgcgggcggcggtggactacgacggcggggtgggcgccggc
gatccgagcctgctggtggaccggacgaccggccgggtcttcctgttccacgcgtacgcg
cccaggggcgtcgggttccgcagcgccggggcgggcaacgcacccgacagcaccggcgtg
ctgcacaccgactacagccgttccgacgacggcggccgccactggcaccaccggcgcctc
acccgtgtcctcaaggacccttcctggcgcggcatcttcgcctcgtccggcgccggcagc
cagctggcgggcggccggctgctccagcagtacgcgttccgcaaggccgacggcagcatg
tgggcggccggcgcgtacagcgacgaccacggggcgagctggcacctggggaggccggtg
gggccgcggatggacgagaacaagacggtcgaactggccgacgggcgcgtcctgctcaac
agccgcaccggcagcgtccgcagacggctggtcgcgcactcccgcgacggcgggctgacc
tacagcgccccggcggtcgacgacgcgctgatcgacccgggcaacaacgcctcgctgctg
cgctacgacccgacggcgccggcccgcctgccgcgcgcccactggctgctgttcagcaac
acggcgagcacccgcgcgcgggagaacctcaccgtgcgggtgtcctgcgacgacggggtg
acctggccgctcgcccggaccgtgacgccgggcgcggcggcctactcgacgctgacccgg
ctcacggacggcacgttcgggctgctctacgagtccgggccctaccggaagctcactttc
gcccggttcgacggcggctggctgggggtcagggcgtgtccggcgggacgggggccggcc
cggccatga

DBGET integrated database retrieval system