KEGG   Streptomyces lydicus: SL103_21435Help
Entry
SL103_21435       CDS       T04699                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
slc  Streptomyces lydicus
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:slc00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    SL103_21435
Enzymes [BR:slc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SL103_21435
DNA repair and recombination proteins [BR:slc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SL103_21435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4915127..4916011)
Genome map
AA seq 294 aa AA seqDB search
MSPITVVEGRRLPLTNLDKVLYPETGTTKGEVVHYCTTTAEPLLAHLHDRPLSFLRYPDG
PDGQRFFTKNVPPGTPSWVKTCEVPHSTSGPTRQALLQDLPSLVWAANLVVELHTPQWTC
RTPGTADRLVLDLDPGDPATVVECCVAAQWLHERLAADGLEVFAKTSGSKGLHLVVPIEP
TPSERTTAYARTLAVEAARALPDLVVHKMAKALRPGKVFIDFSQNAAAKTTAVAYTLRAR
ATPTVSAPVTWDEIADCDDPEQLSFLFGEIGPRIERYGDLHAPLLDPDRARPLP
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgatcaccgtcgtggaggggcggcgccttccgctgaccaacctcgacaaggtc
ctttatcccgagaccggcaccaccaagggtgaggtggtccactactgcaccaccaccgcg
gagccgctgctcgcgcacctccacgaccggccgctgtccttcctgcgctaccccgacggg
cccgacggccagcgcttcttcaccaagaacgtgccgcccggcacgccctcctgggtgaag
acctgcgaggtcccccattcgacgtccgggcccacccggcaggccctgctccaggacctg
ccgtcactcgtctgggccgcgaacctcgtcgtcgaactgcacaccccgcagtggacctgc
cgcacgccgggcaccgccgaccgcctcgtcctcgatctggaccccggcgaccccgccacc
gtcgtcgagtgctgcgtcgcggcgcagtggctgcacgagcggctggccgccgacggcctg
gaggtcttcgccaagaccagcggctccaaggggctgcatctggtcgtgccgatcgagccg
accccgtcggagcggaccaccgcctacgccaggaccctcgccgtcgaggcggccagggcc
ctgccggacctcgtcgtgcacaagatggccaaggcactgcggcccggcaaggtcttcatc
gacttctcccagaacgcggccgccaagaccaccgccgtcgcctacaccctgcgggcccgc
gccacccccaccgtctccgccccggtcacctgggacgagatcgccgactgcgacgacccg
gagcaactcagcttcctcttcggcgagatcggtccccgcatcgagcgctacggcgatctg
cacgcaccgctcctcgacccggaccgggcccgaccgctgccctga

DBGET integrated database retrieval system