KEGG   Streptomyces lydicus: SL103_29315Help
Entry
SL103_29315       CDS       T04699                                 

Gene name
kgd
Definition
(GenBank) alpha-ketoglutarate decarboxylase
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
slc  Streptomyces lydicus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:slc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SL103_29315 (kgd)
  Amino acid metabolism
   00310 Lysine degradation
    SL103_29315 (kgd)
   00380 Tryptophan metabolism
    SL103_29315 (kgd)
Enzymes [BR:slc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     SL103_29315 (kgd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6779798..6783589
Genome map
AA seq 1263 aa AA seqDB search
MSLQSPNSSSISTEADQEGQGKSPAAAFGPNEWLVDEIYQQYLQDPNSVDRAWWDFFADY
KPGGATAPSAPAEGSPGAADAVLPPAAAPDRSAPAAPAQPKPAAAAPATPAKPAASAPAP
AKPAAAKPAAKPAAAKETEAPEGPEYVVLRGPSAAVAKNMNASLELPTATSVRAVPVKLL
FDNRIVINNHLKRARGGKVSFTHIIGYAMVQALKAMPSMNYSFAQKDGKPTLVKPEHVNL
GLAIDLVKPSGERQLVVAAIKAAETMTFFEFWQAYEDIVRRARDNKLTMDDFTGVTASLT
NPGGIGTVHSVPRLMPGQSMIMGVGSMDYPAEFQGTSQDALNKLGVSKVMTLTSTYDHRV
IQGAASGEFLRIMNQLLLGENDFFDDIFKSLRIPYEPVRWLRDIDASHDDDVTKAARVFE
LIHSYRVRGHVMADTDPLEYHQRKHPDLDITEHGLTLWDLEREFAVGGFASKSMMKLRDI
LGVLRDSYCRTTGIEFMHIQDPKQRKWIQDRVERPHKSPEREEQLRILRRLNSAEAFETF
LQTKYVGQKRFSLEGGESVIPLLDAVIDSAAESRLDEVVIGMAHRGRLNVLANIVGKSYA
QIFREFEGNLDPKSMHGSGDVKYHLGAEGTFTGLDGEQITVSLTANPSHLEAVDPVVEGV
ARAKQDIIGKGGTDFTVLPIQLHGDAAFAGQGVVAETLNMSQLRGYRTGGTVHVVINNQV
GFTAAPESSRSSMYATDVARMIEAPIFHVNGDDPEAVVRVARLAFEFRQAFNKDVVIDLI
CYRRRGHNESDNPAFTQPLMYDLIDKKRSVRKLYTESLIGRGDITLEEAEQALQDFQGQL
EKVFTEVRDATTTPAVPEVPQPKAEFPVYVDTAISQEVVKRIAESQVNIPEHITVHPRLL
PQLQRRAAQVEDNTIDWGMGETLAVGSLLMEGTPVRLAGQDSRRGTFGQRHAVLIDRETG
EDYTPLLYLSEDQARFNVYDSLLSEYAAMGFEYGYSLARPESLVMWEAQFGDFVNGAQTI
VDEFISSAEQKWGQTSGVTLLLPHGYEGQGPDHSSARIERFLQLCAQNNMTVAMPTLPSN
YFHLLRWQVHNPHHKPLVVFTPKSMLRLKAASSKTEEFTTGGFRPVIGDASVKAEDVRKV
VFTSGKVYYDLDAERQKRGATDTAIVRIERLYPLPGKELQAEIAKFPNAEKYLWAQEEPA
NQGAWPFLGLNLIDHLDLAVGADVPHGERLRRISRPHSSSPAVGSAKRHQAEQAQLVAEV
FDA
NT seq 3792 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgctacagtcccccaacagctcgagcatctcgaccgaggccgatcaagaggggcag
ggcaagagccctgctgccgcattcggcccgaacgagtggctcgtcgacgagatctaccag
cagtacctccaggacccgaactcggtagaccgagcctggtgggacttcttcgccgactac
aagccgggcggcgccaccgcgccgagcgcaccggcggagggctcccccggtgcggctgac
gccgtgctgccccccgctgctgccccggaccggtcggctcccgccgcgccggcccagccg
aagcctgcagctgccgcgccggcgaccccggcgaagccggccgcgagcgctccggccccg
gccaagcccgccgccgcgaagccggccgcgaagccggccgccgcgaaggagaccgaggcc
cccgaaggccccgagtacgtcgtcctgcgcgggccctcggccgccgtggcgaagaacatg
aacgcctcgctggagctgccgacggccacgtccgtccgcgcggtcccggtgaagctgctg
ttcgacaaccgcatcgtcatcaacaaccatctgaagcgcgcccgtggcgggaaggtctcc
ttcacccacatcatcgggtacgcgatggtgcaggccctcaaggccatgccgtcgatgaac
tactccttcgcgcagaaggacggcaagccgacgctggtcaagcccgagcacgtcaacctc
ggtctggccatcgacctcgtgaagcccagcggtgaacgccagctggtcgtcgcggccatc
aaggcggccgagacgatgaccttcttcgagttctggcaggcgtacgaggacatcgtccgc
cgggcccgcgacaacaagctgacgatggacgacttcaccggggtcaccgcgtcgctgacg
aaccccggcggcatcggcaccgtccactccgtgccgcgtctgatgcccggccagtccatg
atcatgggcgtcggctcgatggactacccggcggagttccagggcacctcccaggacgcc
ctgaacaagctcggcgtctccaaggtcatgacgctgaccagcacgtacgaccaccgcgtg
atccagggcgccgcctccggcgaattcctgcgcatcatgaaccagctgctgctcggcgag
aacgatttcttcgacgacatcttcaagtcgctgcggatcccgtacgagccggtccgctgg
ctgcgggacatcgacgcctcgcacgacgacgacgtcaccaaggccgcccgggtcttcgag
ctgatccactcctaccgggtccgcggccacgtcatggccgacaccgacccgctggagtac
caccagcgcaagcaccccgacctcgacatcaccgagcacggcctcaccctgtgggacctg
gagcgcgagttcgcggtcggcggcttcgccagcaagtccatgatgaagctgcgcgacatc
ctgggcgtgctgcgtgactcgtactgccgcaccaccggcatcgagttcatgcacatccag
gaccccaagcagcgcaagtggatccaggaccgggtcgagcgtccgcacaagtcgcccgag
cgcgaggagcagctgcgcatcctgcgccggctgaactccgccgaggcgttcgagacgttc
ctgcagaccaagtacgtcggccagaagcgcttctcgctggagggcggcgagtccgtcatc
ccgctgctggacgcggtcatcgactccgcggccgagtcgcggctggacgaggtcgtcatc
ggcatggcccaccgcggccgcctcaacgtcctcgccaacatcgtcggcaagtcgtacgcg
cagatcttccgcgagttcgagggcaacctcgacccgaagtcgatgcacggctccggcgac
gtgaagtaccacctgggcgcggagggcaccttcaccggcctggacggcgagcagatcacc
gtctcgctcaccgccaacccctcccacctggaggccgtggacccggtcgtcgagggtgtc
gcgcgcgccaagcaggacatcatcggcaagggcggcacggacttcaccgtcctgccgatc
cagctgcacggtgacgcggcgttcgccggccagggcgtggtcgccgagacgctgaacatg
tcgcagctgcgcggctaccgcaccggcggcacggtgcacgtcgtcatcaacaaccaggtc
ggcttcaccgccgccccggagtcgtcgcgctcctccatgtacgccaccgacgtggcccgc
atgatcgaggcgccgatcttccacgtgaacggtgacgaccccgaggccgtcgtccgcgtc
gcccgtctggccttcgagttccgccaggcgttcaacaaggacgtggtcatcgacctgatc
tgctaccgccgccgcgggcacaacgagtcggacaacccggccttcacccagccgctgatg
tacgacctgatcgacaagaagcgctcggtgcgcaagctgtacaccgagtcgctgatcggc
cggggcgacatcaccctcgaagaggcggagcaggcgctccaggacttccagggccagctg
gagaaggtcttcaccgaggtccgtgacgccacgacgaccccggccgtgcccgaggtgccg
cagcccaaggcggagttcccggtctacgtcgacaccgcgatctcccaggaggtcgtcaag
cggatcgccgagtcgcaggtgaacatccccgagcacatcaccgtgcatccgcgtctgctg
ccgcagttgcagcgccgcgcggcccaggtcgaggacaacaccatcgactggggcatgggc
gagaccctcgccgtcggctcgctgctgatggagggcaccccggtccggctcgccggccag
gactcccgccgcggcacgttcggccagcgccacgcggtgctgatcgaccgggagaccggc
gaggactacaccccgctgctctacctgtccgaggaccaggcccgcttcaacgtctacgac
tcgctgctcagcgagtacgcggcgatgggcttcgagtacggctactcgctggcccgcccg
gagtcgctggtcatgtgggaggcgcagttcggcgacttcgtcaacggcgcccagacgatc
gtggacgagttcatctcctccgccgagcagaagtggggccagacgtccggcgtcaccctg
ctgctcccgcacggctacgagggccagggcccggaccactcctcggcccgcatcgagcgg
ttcctccagctgtgcgcgcagaacaacatgaccgtcgcgatgccgacgctgccgtcgaac
tacttccacctcctgcggtggcaggtgcacaacccgcaccacaagccgctggtcgtcttc
accccgaagtcgatgctgcgcctgaaggccgcgtcgtcgaagacggaggagttcaccacg
ggcggcttccgtcccgtcatcggtgacgcgtcggtcaaggccgaggacgtccgcaaggtc
gtcttcacctccggcaaggtctactacgacctggacgccgagcggcagaagcgcggcgcg
accgacaccgcgatcgtccgcatcgagcggctgtacccgctgcccggcaaggaactccag
gcggagatcgccaagttcccgaacgccgagaagtacctgtgggcgcaggaagagccggcg
aaccagggtgcctggccgttcctcggcctcaacctgatcgaccacctcgacctggccgtc
ggcgcggacgtgccgcacggcgagcgcctgcgccgcatctcgcggccgcactcctcgtcg
ccggccgtcggttccgccaagcgtcaccaggcggagcaggcacagctggtcgcggaggtc
ttcgacgcgtaa

DBGET integrated database retrieval system