KEGG   Streptomyces sp. A02: T261_1796Help
Entry
T261_1796         CDS       T03756                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
sld  Streptomyces sp. A02
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sld00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    T261_1796
Enzymes [BR:sld01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     T261_1796
DNA repair and recombination proteins [BR:sld03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     T261_1796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1904220..1905203
Genome map
AA seq 327 aa AA seqDB search
MARNMVPTAESGFLPYPEIRPMLATVGPLPAEHEQAAWAFEAKWDGARCIVSTPGDGTVR
LVTRAGNEATATYPELAPLGEQLRGRPAVLDGEVVVLDARGRPDFGLLQRRMGVVNPRRT
ARLAMEYPVHLVLFDVMYLGRSVLGAPYYERRGMLSQLGLRGPNWSVPGYVEGQGQQAWE
ASLRGGIEGVVAKRLTSPYTPGVRSPEWRKTKHLVTLDVVIGGWTEGHGSLTGLPGAVLA
GVGEASGLRYVGSVGSGLSDRERRDLAQYLGVIPLGHSPFINPVDVTGAHWAEPRLIAEI
TFTGWTSAGRLRHPIWHRLRPDLTRLG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggcccggaatatggtgccgaccgccgagtccggcttcctcccgtaccccgagatccgg
ccgatgctggccaccgtcggcccactgcccgccgagcacgagcaggcggcctgggcgttc
gaggccaaatgggacggtgcgcgctgcatcgtcagcacgccgggcgacggtacggtccgg
ctggtcacccgggcgggcaatgaggcgaccgcgacgtacccggagcttgcgccgctgggc
gagcagttgcgcgggcggcccgcggtgctggacggcgaggtcgtggtgctcgatgcgcgg
ggacggcccgacttcgggctgctgcagcgccggatgggggtggtgaatccgcgccgcacg
gcccggctggccatggaatacccggtgcacctcgttctcttcgacgtgatgtatctgggc
cgctcggtgctcggcgcgccgtattacgagcggcgcgggatgctgtcgcagctggggctg
cgcggccccaactggtcggtgccggggtatgtggagggccaggggcagcaggcgtgggag
gcgtcgctgcggggcggcatcgagggcgtggtggcgaagaggctgacctcgccgtacaca
ccaggcgtccggtcacccgagtggcgcaagaccaagcatctggtgacgctcgatgtggtc
atcggcggctggacggagggacacggcagcctcaccgggcttcccggcgccgtcttggcg
ggcgtcggggaggcgagcgggctgcggtacgtcggctccgtgggctcgggcctgtccgac
cgggagcggcgggacctcgcgcagtatctgggggtgatcccgctgggccactcgcccttc
atcaatcctgtcgatgtgacgggcgcccactgggccgagccccggctgatcgccgagatc
accttcaccggctggacgtcggcgggacggctgcggcacccgatctggcaccggctgcgg
cccgatctgacccgcctgggctga

DBGET integrated database retrieval system