KEGG   Streptomyces sp. A02: T261_4744Help
Entry
T261_4744         CDS       T03756                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sld  Streptomyces sp. A02
Pathway
sld00564  Glycerophospholipid metabolism
sld01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sld00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    T261_4744
Enzymes [BR:sld01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     T261_4744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AJT66383
UniProt: A0A0D4DRR9
LinkDB All DBs
Position
5032587..5034242
Genome map
AA seq 551 aa AA seqDB search
MAERELDILVVGGGVVGAGTALDAATRGLATGLVEARDWASGTSSRSSKLIHGGLRYLEM
LDFALVREALKERGLLLQRLAPHLVKPVPFLYPLQHRGWERWYAGSGVALYDGMSVSSGH
GRGLPVHRHLSHKRALRVAPCLKSDALVGALQYYDAQMDDARYVATMVRTAAAYGAQCAN
RARVVGFLREGERVVGARVQDVEAGGEYDVRARQIVNATGVWTDDTQALIGERGQFHVRA
SKGIHLVVPKDRIHSTTGLILRTEKSVLFVIPWGRHWIIGTTDTDWDLDKAHPAASSADI
DYLLEHVNSVLAIPLTRDDVEGVYAGLRPLLAGESDATSKLSREHTVAHPVPGLVVVAGG
KYTTYRVMAKDAVDEAVHGLDQRVAECVTEDVPLVGAEGYKALWNARARIAARTGLHVAR
IEHLLNRYGSLTEELLELVVADPSLGEPLAAADDYLRAEAVYACTHEGARHLDDVLTRRT
RISIETFDRGTLSAREVAELIAPALGWDSAQIEKEIAHYEKRVEAERESQRQPDDLTADA
ARLGAPDIVPL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggcggagcgcgagctggacattctggtcgtcggcggtggggtcgtcggcgccggtacg
gcgctggacgcggcgacccgcgggctcgccaccgggctggtcgaggcgcgcgactgggcc
tcgggcacctccagccgctcgagcaagctcatccacggcggcctgcggtatctggagatg
ctcgactttgcgctggtgagggaggcgttgaaggagcgggggctgttgctgcagcgactg
gcgccgcatctcgtgaagccggttccgttcctgtatccgttgcagcaccgggggtgggag
cgctggtacgcggggtcgggtgtggcgctgtacgacgggatgtcggtgtcgtcggggcat
ggccgggggctgcccgtgcaccggcacctctcccacaagcgggccctgcgggtggccccc
tgcctgaagagcgacgcgctggtcggcgcgctgcagtactacgacgcccagatggacgac
gcgcgctatgtggcgacgatggtgcgcaccgccgccgcgtacggggcgcagtgcgccaac
cgggcgcgcgtggtgggttttctgcgcgagggcgaacgggtggtcggcgcgcgggtacag
gacgtcgaggcgggcggcgagtacgacgtccgcgcccggcagatcgtcaacgccaccggg
gtgtggaccgatgacacccaggcgctgatcggtgagcgcgggcagttccacgtccgcgcc
tcgaaaggaattcacctggttgtcccaaaggaccggatccattccacgaccgggctcatc
ctccgtacggagaagagcgtgctgttcgtcatcccctgggggcgccactggatcatcggg
acgacggacaccgactgggacctggacaaggcgcatcccgccgcctccagcgccgatatc
gactatctgctggagcatgtgaactccgtcctcgccataccgctgaccagggacgatgtc
gagggtgtgtatgccggtctgcggccgttgctggccggggagtcggatgcgaccagcaag
ctgtcgcgcgagcacaccgtcgcgcacccggtgccggggctggtcgtggtggccggcggc
aagtacacgacgtaccgggtgatggccaaggacgccgtggacgaggcggtgcacggcctg
gaccagcgggtcgcggagtgtgtcacggaggacgttccgctggtcggcgccgagggctac
aaggcgctgtggaacgcacgggcccggatcgcggcgcgcaccggcctccatgtcgcccgc
atcgagcacctcctgaaccgctacggctcgctcaccgaggagctgctggaactcgtggtg
gccgatccttcactgggcgaaccgctcgccgccgcggacgactatctgcgcgccgaggcc
gtctacgcctgtacgcatgagggcgcccggcacctcgacgacgtcctgacccgccgcacc
cggatctccatcgagaccttcgaccgcgggaccctcagcgcccgcgaggtcgccgagctg
atcgcgcccgcgctgggctgggacagcgcccagatcgagaaggagatcgcgcactacgag
aagcgggtcgaggcggagcgcgaatcccagcggcagccggacgatctgacggcggatgcg
gcgcggctgggggcgccggacatcgtgccgctgtag

DBGET integrated database retrieval system