KEGG   Streptomyces sp. A02: T261_4956Help
Entry
T261_4956         CDS       T03756                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sld  Streptomyces sp. A02
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sld00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    T261_4956
  Energy metabolism
   00680 Methane metabolism
    T261_4956
Enzymes [BR:sld01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     T261_4956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5264312..5267083
Genome map
AA seq 923 aa AA seqDB search
MSSADNTAESVPTPNTDTTDGAARDNTALRADIRRLGDLLGETLVRQEGEELLELVERVR
ALTRSDGEAAARLLGDTDLATATKLVRAFSTYFHLANVTEQVHRGRELRARRATEGGILA
RTADMLKDADPEHLRETARNLGVRPVFTAHPTEAARRSVLTKLRKVAELLDHADATERRR
TDLRLAENIDLIWQTDELRVARPEPTDEARNAIYYLDELGRGAVGDVLEDLAAELERAGT
ELPAGTRPLTFGTWIGGDRDGNPNVTPQVTWDVLILQHEHGITDALEHIDELRNALSNSI
RNCGATDELLDSLQRDLELLPEFSPRYKRLNAEEPYRLKATCIRQKLLNTRDRLAGDTPH
VPGRDYLGTAELLDDLALIQTSLRAHRGGLVADGRLERTLRTIAAFGLQLATMDVREHAD
AHHQALGQLFDRLGEESWRYVDMPRDYRRKLLAKELRSRRPLAPTPAPLDEAGAKTLGVF
RTILKAKDTFGPEVIESYIISMCQGSDDVFAAAVLAREAGLIDLHAGWAKIGIVPLLETT
DELKIADQLLDEMLSDPSYRRLVALRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRLLR
DVAHRHGVRLRLFHGRGGTVGRGGGPSHDAILAQPYGTLEGEIKVTEQGEVISDKYLVPS
LARENLELTVAATLQASALHTAPRQSDEALARWDAAMETVSDAAHGAYRRLVEDPDLPAY
FFASTPVDQLAELHLGSRPSRRPDSGAGLDGLRAIPWVFGWTQSRQIVPGWYGVGTGLKA
AREAGLDTVLDEMHAHWHFFRNFLSNVEMTLAKTDLRIAQHYVDTLVPDELKHIFDVIKA
EHELTVQEVLRITGETELLDSNPVLKQTFHIRDAYLDPISYLQVSLLDRQREAAARGEEA
DPVLSRALLLTVNGVAAGLRNTG
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgacaacaccgccgagtccgtgcccaccccgaacacggacaccaccgat
ggcgccgcccgcgacaacaccgcgctgcgcgccgacatccgccgtctcggcgacctcctc
ggtgaaaccctcgtccggcaggaaggggaagagctgctggagctggtggaacgcgtacgc
gccctgacccgctccgacggcgaggccgccgcccggctcctgggcgacaccgacctggcc
accgccaccaagctggtccgcgccttctccacctacttccacctcgccaacgtcaccgag
caggtccaccgcggccgcgaactgcgcgcccgccgcgccaccgagggcggcatcctggcc
cgcaccgccgacatgctcaaggacgccgaccccgagcacctgcgggaaaccgcccgcaac
ctcggtgtacgccccgtcttcaccgcccaccccaccgaggccgcccgccgctccgtcctc
accaagctccgcaaggtcgccgagctcctcgaccacgcggacgccaccgaacgccgccgc
accgacctccgcctcgccgagaacatcgacctgatctggcagacggacgagctgcgggtc
gcccggccggagcccacggacgaggcccgcaacgccatctactacctcgacgagctgggc
cgcggcgccgtcggcgacgtcctcgaagacctcgccgccgagctggaacgggccggcacc
gagctgcccgccggcacccgccccctcaccttcggcacctggatcggcggcgaccgcgac
ggcaaccccaacgtgaccccgcaggtcacctgggacgtcctgatcctccagcacgagcac
ggcatcaccgacgcactggagcacatcgacgagctgcgcaacgcgctctcgaactccatc
cgcaactgcggcgccaccgacgagctcctggactcgctccagcgcgacctcgagctgctc
cccgaattcagcccccgctacaagcggctgaacgccgaggagccctaccgcctcaaggcc
acctgcatccgccagaagctcctcaacacccgcgaccgcctcgccggcgacaccccccac
gtccccggccgcgactacctcggcaccgccgaactcctcgacgacctcgccctcatccag
acctcgctgcgcgcccaccgcggcggcctggtcgccgacggccgcctcgagcgcaccctg
cgcaccatcgccgccttcggcctccagctcgccaccatggacgtccgcgaacacgccgac
gcccaccaccaggcactcggccagctcttcgaccgcctcggcgaggaatcctggcgctac
gtggacatgccgcgcgactaccggcgcaagctgctcgccaaggagctgcgctcacgccgc
ccgctcgcccccacccccgcccccctcgacgaggccggcgccaagaccctcggcgtcttc
cgcacgatcctcaaggccaaggacaccttcggccccgaggtcatcgagtcctacatcatc
tccatgtgccagggctcggacgacgtcttcgccgcggccgtcctggcccgcgaagccggg
ctcatcgacctgcacgccggatgggccaagatcggcatcgtcccgctgctggagaccacc
gacgagctgaagatcgccgaccagctcctcgacgaaatgctctccgacccctcctaccgg
cgactggtcgccctgcgcggggacgtccaggaagtcatgctcggctactccgactcctcc
aagttcggcggcatcaccacctcccagtgggagatccaccgcgcccagcgcctgctgcgc
gacgtcgcccaccggcacggcgtacggctccgcctcttccacggccgcggcggcaccgtc
ggccgcggcggcggcccctcccacgacgcgatcctcgcccagccctacggcacgctcgaa
ggcgagatcaaggtcaccgagcagggcgaggtcatctccgacaagtacctcgtcccctca
ctggcacgggaaaacctggagctcacggtcgcggccaccctccaggcctccgccctgcac
accgccccccggcagtccgacgaggccctcgcccgctgggacgccgccatggagaccgtc
tccgacgccgcccacggcgcctaccgccggctcgtcgaggaccccgacctcccggcgtac
ttcttcgcctccacccccgtcgaccagctcgccgaactccacctcggctcccgcccgtcc
cgccgccccgactccggcgccggcctcgacggactgcgcgccatcccctgggtcttcggc
tggacccagtcccgccagatcgtccccggctggtacggcgtcggcacgggactgaaggcc
gcccgcgaggccggactcgacaccgtcctcgacgaaatgcacgcgcactggcacttcttc
cgcaacttcctctccaacgtggagatgacactcgccaagaccgacctgcggatcgcccag
cactacgtcgacaccctcgtccccgacgagctcaagcacatcttcgacgtcatcaaggcc
gaacacgagctcaccgtccaggaagtcctgcgcatcaccggagagaccgaactcctcgac
tccaacccggtcctgaagcagaccttccacatccgcgacgcctacctcgacccgatctcc
tacctccaggtctccctgctggaccgccagcgcgaagccgccgccaggggagaggaagcc
gacccggtgctctcccgcgcgctgctgctgaccgtcaacggcgtagcggccggcctgcgc
aacaccggctga

DBGET integrated database retrieval system