KEGG   Streptomyces sp. A02: T261_6984Help
Entry
T261_6984         CDS       T03756                                 

Definition
(GenBank) Sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
sld  Streptomyces sp. A02
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sld00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    T261_6984
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    T261_6984
Enzymes [BR:sld01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     T261_6984
Bacterial toxins [BR:sld02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   T261_6984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(7503875..7505125)
Genome map
AA seq 416 aa AA seqDB search
MYAALSARAARSLSLAVALAAGTGLATATPAAPAPEPPPPDTAAPRHRPGPRHGPTPGHE
PAPLYESTDVAVSGQGAHTYRIPALATLPDGTLVAAYDRRNNSAADLPGDVDVMVRRSTD
NGRTWSPPQAVADYDGGAGAGDPSLLADRWTGRLFLFHAYGPKGIGFGNAGMGNDHDSTT
ILHTDLHYSDDGGRSWRARRLTHDLKDPTWLGIFASSGTAIQLSTGRLLQQYAFRKADAS
MWAASAYSDDHGETWRLGTPVGPLMDENKTVELADGRIMLNSRTGSTTRRLVAHSRDGGL
TYSSPVADDELIDPVNNASVLRYDPTAPPGHPRAHWLLFSNTASATARRNLTVRLSCDDG
RSWPVSRVVTPGPSAYSTLTRLKDGTFGLLYESGPYRKITFARFDGAWLGAGCPAA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtgtatgccgccctttcggcgagagccgcacgttccctgtcgctggccgtcgcgctcgcc
gccggcaccggtctggcgacggccacccccgcggcccccgcccccgagccgccgcccccg
gacaccgccgccccccgccaccggcccggcccccgccacggtccgactcccggtcacgag
cccgctcccctctacgagtccaccgatgtggcggtctccggccagggcgcgcacacctac
cgcatccccgccctcgcgacgctccccgacggcacgctcgtcgccgcctacgaccggcgc
aacaacagcgccgccgacctgcccggcgacgtggacgtgatggtgcggcgcagcaccgac
aacggacggacgtggagcccgccgcaggcggtcgccgactacgacggcggggcgggcgcc
ggtgaccccagtctgctcgccgaccggtggaccggccgcctcttcctcttccacgcgtac
ggccccaagggcatcggcttcggcaacgcgggcatgggcaacgaccacgacagcaccacg
atcctgcacaccgatctccactactccgacgacggcggccgcagctggcgcgcccggcgc
ctgacccacgacctcaaggacccgacctggctcggcatcttcgcctcgtccggcaccgcc
atccagctgtccaccggacggctgctgcagcagtacgcgttccgtaaggccgacgccagc
atgtgggcggccagtgcgtacagcgacgaccacggggagacgtggcgtctggggacgccg
gtcgggccgctgatggacgagaacaagaccgtcgagctggccgatggccgcatcatgctc
aacagccgcaccggcagcaccaccagacggctggtcgcccactcccgggacggcgggctg
acctacagctccccggtcgcggacgacgagctgatcgacccggtcaacaacgcgtcggtc
ctgcgctacgaccccaccgcgccgcccggccacccgcgggcgcactggctgctgttcagc
aatacggccagcgccaccgcccggcggaacctcaccgtccggctgtcctgcgacgacggg
cgcagctggcccgtgtcccgggtcgtgacgcccggaccgtcggcgtattcgacgctgacc
cggctgaaggacggcacgttcgggctgctctacgagtcggggccgtaccggaagatcacg
ttcgcgcggttcgacggcgcctggctgggggcgggctgcccggccgcatga

DBGET integrated database retrieval system