KEGG   Shewanella loihica: Shew_2053Help
Entry
Shew_2053         CDS       T00489                                 

Definition
(GenBank) Peptidyl-dipeptidase A
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
slo  Shewanella loihica
Brite
Enzymes [BR:slo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Shew_2053
Peptidases [BR:slo01002]
 Metallo Peptidases
  Family M2
   Shew_2053
Exosome [BR:slo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Shew_2053
CD molecules [BR:slo04090]
 Proteins
  Shew_2053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2371154..2373058
Genome map
AA seq 634 aa AA seqDB search
MKPICAKLTPVAVVIALSLGIGGCNDDNNANTESKATAESKAQQAAGQDGLKQQTSEQDK
LAEAKQFISNAESQLADLSIEQNRAEWIYSNFITEDTATLAASVGERQTALSVQLATQAA
NYSQLPLDEVNTRKLNILRSALVLPAPLDPKKNAELANISAELNGLYGKGKYCLADGRCL
TQPELSGIMASSRDPKELEEIWKGWREIAKPMRPLFEREVELANEGAKDLGYANLSELWR
SQYDMQPDAFSAELDRLWGQVEPLYESLHCYVRGELNEKYGDEVAPNKGPIPAHLLGNMW
AQQWGNVYDMVAPQDADPGYDVTELLAKQGYDEHQMVKQAEGFFTSLGFDALPETFWSRS
LFLQPKDRDVVCHASAWDLNNLDDIRIKMCIQKTAEDFTVIHHELGHNFYQRAYKEQPFI
FKNSANDGFHEAIGDTVALSITPNYLKQIGLLQEVPDASKDIGLLLRQALDKVAFLPFGL
MIDQWRWKVFSGEITPAQYNQAWWELREKYQGVKAPIARSEADFDPGAKYHVPGNVPYTR
YFLAHILQFQFHKALCDIAGDKGPVHRCSIYGNKDAGAKLNAMLEMGQSKPWPEALEVVT
GSQNMDASAVLDYFAPLKVWLDKQNKQANRQCGW
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaatttgtgccaagttgactccggttgccgtggtcatcgcactctctctaggg
atcggcggctgtaatgacgataacaatgctaatacagaaagcaaggccactgcagaaagc
aaagcccagcaggcagcagggcaagatggtctaaaacagcaaacctctgagcaagataag
ctggccgaagccaaacagtttatcagcaatgccgagagccaactcgccgatctgtctatt
gaacaaaatcgcgccgagtggatctacagcaacttcatcactgaagacacggccaccctc
gccgcctctgtcggcgaacgccaaaccgccctatcggtacaactcgccacccaagccgcc
aactatagccagctgccactggatgaggtcaacacacgtaaactcaacatcttacgtagc
gcattggtgctgccggcccctctggatcctaagaagaatgccgaacttgccaatatcagc
gccgagctaaatggcctctatggtaaaggcaaatactgtctggccgatggacgctgtctc
actcagccagagctttcgggcatcatggccagctcacgcgatcctaaagagcttgaggag
atctggaaaggctggcgtgagatcgccaagccgatgcgtcccctgtttgagcgcgaggtg
gagttagccaacgaaggagctaaagatctgggttatgccaacctctctgaactctggcgt
agccagtacgacatgcagcccgatgccttctctgcagagctcgacagactctggggccaa
gtagagcctctgtatgaatcgctgcactgttatgtcaggggcgagctgaacgaaaaatat
ggtgatgaagtcgcacctaacaaaggccctattccagcacatctgcttggcaacatgtgg
gcgcagcaatggggtaacgtctatgacatggtggcgccacaagatgcggaccctggctat
gatgtgaccgagctgctggcgaaacagggctatgatgagcatcagatggttaaacaggcc
gagggcttcttcacctcgctcggtttcgacgcactgcctgagaccttctggagccgttcg
ctcttcctgcagcccaaggatcgcgatgtggtctgtcacgcctcggcctgggatctcaat
aacctagatgatattcgtatcaagatgtgtatccagaagacggcagaagatttcaccgtt
attcaccatgaactgggccacaacttctatcaacgcgcctataaagagcagcccttcatc
tttaagaacagtgccaacgatggcttccatgaggcgattggtgacacggtcgccctgtct
atcacgcctaactacctgaagcagataggcctactgcaagaggtgccagatgcctccaaa
gatatcggtctcttgctaagacaggcacttgataaggtggccttcctgccctttggcctc
atgatagatcaatggcgctggaaggtattcagcggcgagatcactccagcacaatacaac
caagcctggtgggagctgcgtgagaagtatcagggcgttaaggcgccaatcgcccgcagc
gaagccgacttcgacccgggtgccaagtaccatgtacccggcaacgtgccctacacccgc
tacttcctggcgcatattctccagttccagttccataaggcgctgtgtgatatcgccggc
gataagggcccggttcaccgttgcagcatctacggtaacaaggatgcgggcgctaagcta
aacgccatgttagagatgggtcagagtaagccttggccagaagcccttgaagtggtcact
ggctcgcaaaacatggatgcctctgcggtactcgattactttgcgccgctaaaagtctgg
ctggataagcagaacaagcaggctaaccgtcagtgtggctggtaa

DBGET integrated database retrieval system