KEGG   Shewanella loihica: Shew_2535Help
Entry
Shew_2535         CDS       T00489                                 

Definition
(GenBank) Pyridoxal-dependent decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
slo  Shewanella loihica
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:slo00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Shew_2535
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Shew_2535
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Shew_2535
   00430 Taurine and hypotaurine metabolism
    Shew_2535
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Shew_2535
Enzymes [BR:slo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Shew_2535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2992865..2994505
Genome map
AA seq 546 aa AA seqDB search
MTSKQTRQATASEEALMRIFTLPEAPNSTLGKIEKNLSENLMGFLKESIVAVEKPLTEIE
KDFQAYQIPTAPSFVSDYAEQMMQTLIAHSVHTSAPSFIGHMTSALPYFVLPLSKMMVGL
NQNLVKIETSKAFTPLERQVLGMMHHMVYGQTEEFYQSWMHSASHSLGAFCSGGTVANIT
ALWIARNRLLKPDGDFKGVAQSGLMRALRHYGYDDLAILVSTRGHYSLGKAADLLGIGRD
NIISVPCASDNKVDVAKMREAAEQLAEQNIKVMAIVGVAGTTETGNIDPLDELANLAEQL
GCHFHVDAAWGGASLLSSKYRHLLAGIERADSVTIDAHKQMYVPMGAGMVLFKDPEFANA
IKHHAEYILRKGSKDLGSQTLEGSRPGMAMLVHACLQIIGRDGYEILINNSLEKARYFGE
LIAAQDDFQLVSRPELCLLTYRYVPAKVQAQLNEAVAAGDAARVSEINALLDGLTKFIQK
RQREQGKSFVSRTRIIPANNLEQTSVVFRVVLANPLTSNEILQQVLDEQRDIAKLDDRFL
PKLLAL
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaaacagacacgacaagcgaccgcctctgaagaggccttgatgcgtattttc
actctgcccgaggcaccgaattcgaccctgggtaagatagagaaaaacctgtcggaaaac
ctgatgggcttcctcaaagagagtatcgtcgcagtcgagaagccgctgaccgaaatagaa
aaagatttccaggcctaccagatccccacagcccccagcttcgtctccgactatgccgag
cagatgatgcagaccctgatcgcccacagcgtgcacacctcggctcccagcttcataggt
catatgacctcggccctgccctatttcgtgctgccactgtcgaagatgatggtgggactc
aaccaaaatctggtgaagatagagacctccaaggccttcacgccgctggagcgccaggtg
ctggggatgatgcaccacatggtctatggccagacagaagagttctaccagagctggatg
cacagcgccagtcactcattaggcgccttctgctccggcggcacggtcgccaacatcacg
gcgctgtggatcgcccgtaaccgtctgttaaagccggacggcgacttcaagggggtggcc
caatctggcctgatgcgagcactgcgccactacggctatgacgatctggccattctggta
tcaactcgaggtcactactccctcggcaaggccgcagatctgttaggcataggccgcgac
aacatcatcagcgtgccctgcgctagcgataacaaggtagatgtggccaagatgcgcgaa
gcggccgagcagttagccgagcagaacatcaaggtgatggcgattgtcggcgtggccggc
accacggagacaggtaatatcgacccgctcgatgagcttgcgaatctcgccgagcagctg
ggttgccacttccatgtggatgccgcctggggtggtgccagcctgctgtcgagcaagtat
cgccacctgttagccggcatagagcgcgccgactcagtcactatcgatgcccacaagcag
atgtacgtgcccatgggcgcaggtatggtgctatttaaagacccggaatttgccaacgcc
atcaaacaccacgccgaatatattctgcgtaagggctcgaaagatctgggtagccagacg
ctggaggggtcacgtcccggcatggccatgctggttcatgcctgcttacagatcatcggc
cgcgacggctatgagatcttaatcaacaacagcctggagaaggcgcgttacttcggcgag
ctgatcgccgctcaggacgattttcagctggtttccaggcctgagctctgcctgctgacc
taccgctatgtgccagccaaggtgcaggcgcagctcaatgaggcggtcgcagccggtgac
gcggcccgtgtgagcgagattaatgcattgcttgacggcctgacaaagtttatccagaag
cgccaacgtgagcagggaaaatccttcgtctcccgtacccgcatcattccagccaataac
ctggagcagacctctgtggtgttccgcgtggtactggccaaccctttgaccagtaatgag
atcttacagcaggtattggatgagcagcgcgacatcgccaagctagacgaccgcttcctg
cctaagctgctggccctatag

DBGET integrated database retrieval system