KEGG   Syntrophothermus lipocalidus: Slip_0511Help
Entry
Slip_0511         CDS       T01253                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
slp  Syntrophothermus lipocalidus
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:slp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Slip_0511
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Slip_0511
Enzymes [BR:slp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Slip_0511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
522169..523437
Genome map
AA seq 422 aa AA seqDB search
MVEGEKIRVVNGALQVPDNPIIPFIIGDGTGPDIWAAASRVLEAAVERAYQGKKKIVWKE
ILAGEKAFNLIGQWLPQETIDTIREYVIAIKGPLTTPIGGGIRSLNVALRQELDLYACVR
PVRYFKGVPSPVKRPEDTDMVIFRENTEDIYAGIEWPKGSEEVKKVIRFLKDEMGVKNIR
FPETSAIGIKPISEEGSKRLVRAAIRYALSEGRKSVTLVHKGNIMKFTEGGFKNWGYEVA
EQEFGDHVFTWNQYDEIKERKGEKAANEAQAEAEAQGKLIVKDVIADIFLQQILTRPREF
DVIATMNLNGDYISDALAAQVGGIGIAPGANINYDTGHAVFEATHGTAPKYAGLDKVNPS
SVLLSGEMMLRHLGWHEAADLIIGAVERTIASKIVTYDFARLMEGATEVKCSEFGDALIQ
NL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttggtcgagggtgaaaaaatcagggtggtcaacggagcgctgcaggttccggataatccg
ataattccttttattatcggtgatggtaccgggcccgatatatgggcagcagcatcaagg
gtactcgaggctgcggtagaaagagcatatcagggcaagaaaaaaattgtatggaaagag
attctcgcgggtgaaaaggcttttaacttgataggacagtggcttcctcaggaaaccata
gataccatcagggagtacgttatagcaataaaagggccacttactactcctataggtggc
ggcatccgttctctgaacgtggctttgcggcaagagctggatctatatgcctgtgttaga
ccggtgcgttatttcaaaggagtaccatctccggtcaaaaggcccgaggacacggacatg
gtgatatttagagaaaatacagaagacatctatgcaggcatcgagtggccaaaagggtcg
gaagaggtcaagaaggtcataaggttcttaaaagacgaaatgggagtgaaaaacataagg
tttcccgaaacatcggccattggcataaagcccatatcggaagaagggagcaagaggctg
gttcgagcggcaataaggtatgcgctgagcgaaggacgaaagagcgtgaccctggttcac
aaggggaacattatgaagtttactgagggaggcttcaagaactgggggtacgaagtagcg
gaacaggagtttggggaccacgtctttacctggaaccagtacgatgagatcaaggaacgt
aaaggagaaaaagcagctaatgaggctcaagcagaggctgaggcccagggcaagctcata
gttaaggacgtaattgccgatatctttttgcagcagatactgacccgtcctcgagaattc
gatgttatagctactatgaacctcaatggtgattacatttctgatgcgttagccgcgcag
gtaggggggattggaattgccccaggagctaacatcaactatgatactggacatgcggta
tttgaagcaacccacggaacagctcccaaatacgccgggctggacaaggtcaatccttcc
tcggttcttttgtcaggggaaatgatgttgcggcacttgggatggcatgaagccgcggat
ctcattataggagctgtggaaagaaccatagcgagtaagatcgtgacctatgactttgcc
cggttgatggagggcgcaaccgaagtaaaatgctcggaattcggggatgctctaattcaa
aacctgtag

DBGET integrated database retrieval system