KEGG   Syntrophothermus lipocalidus: Slip_1509Help
Entry
Slip_1509         CDS       T01253                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
slp  Syntrophothermus lipocalidus
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:slp00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Slip_1509
Enzymes [BR:slp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Slip_1509
DNA repair and recombination proteins [BR:slp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Slip_1509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1566306..1567244)
Genome map
AA seq 312 aa AA seqDB search
MVMPVIKPGTPFIPMEPVFHPEAFDDENYGFQIKWDGTRIIAHLDGPVELFNRKMKKRTA
QYPEVADALKEALRGTSAVLDGEIVTLSGDKPNFHQLMRRDRATDARTINHLATRIPVTY
VVFDILYLKDKCLADLPFWQRDGILRSTLKSSDPVVVTDTFKGRGKALFAIVREKGLEGI
VAKRLESTYQIGKKSAKWLKIKNRQRTTALVGGFVAEGKQVRSLFLGQLVEGDLIYIGRA
SSGLDEETGRALYDFLSRRAENTCPFVNPPAVERRENLVWVLPSASVEVEFYDYTEKGYL
RHPVIKRVELGL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgcctgtgataaagccgggaacccccttcattcccatggaaccggtcttccac
ccggaggcctttgacgatgaaaactacggttttcagataaagtgggacggaacaaggata
atagcccacctggacgggccggtggaacttttcaaccggaagatgaaaaagcgcaccgcc
cagtatcccgaagtggccgatgcgttgaaggaggcccttaggggcacaagcgccgtgctg
gacggggaaatcgtaaccctttccggcgataagcccaatttccaccagctgatgaggcgt
gaccgggccaccgacgcgcgcaccataaaccacctggccaccagaataccggtgacctat
gtggtctttgacatcctgtacctaaaagataagtgcctggcggaccttcccttttggcag
cgggacgggatattgagatccaccttaaaatcttcggacccggtggtggtaaccgatacc
ttcaagggacgtgggaaggccctttttgcaatcgtcagggaaaagggtctggagggcata
gtggccaaaagactggaaagtacctaccagatcggaaagaaaagtgcaaaatggcttaaa
attaaaaaccgccagcggaccaccgccctggtgggggggtttgtagcagaagggaagcag
gtgcggtccctctttctcggccagcttgtggaaggggacttaatctatataggccgggct
tccagcggcctcgatgaggaaacgggcagggctctttacgactttctatcccggagggcc
gaaaatacctgtcccttcgtcaatccgcccgccgtggaaagaagggaaaatctcgtatgg
gtactaccgtcagcttccgttgaagtggaattttacgactacacggagaaaggttatctc
agacacccggtcatcaagcgggtggaactggggttatga

DBGET integrated database retrieval system