KEGG   Sideroxydans lithotrophicus: Slit_0986Help
Entry
Slit_0986         CDS       T01196                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
slt  Sideroxydans lithotrophicus
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:slt00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Slit_0986
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Slit_0986
Enzymes [BR:slt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Slit_0986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
970544..970900
Genome map
AA seq 118 aa AA seqDB search
MSEVMDYKSRLSDPASRKFETFSYLPAMTADQIKKQVEYLVSKGWNPAIEHIEPEYLMDS
YWYMWKLPMFGETDVTKVLAEAEACHKANPNNHVRLIGYNNFNQSQGAAMVIFRGKTV
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagtaatggattacaaatcacgtttgtccgaccctgccagccgcaagttcgag
acattctcctacctgccggcaatgaccgccgaccagatcaagaagcaggtggagtacctg
gtttccaaaggctggaatcccgccatcgagcatatcgagccggaatacctgatggactcc
tactggtacatgtggaagctgccgatgttcggcgagaccgacgtgaccaaggtattggcg
gaagccgaagcctgccacaaggccaaccccaacaaccacgtgcgcctgatcggttataac
aacttcaaccagtcccagggcgcggccatggtgatcttccgcggcaagacggtttga

DBGET integrated database retrieval system