KEGG   Streptococcus lutetiensis: KE3_0608Help
Entry
KE3_0608          CDS       T02775                                 

Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
slu  Streptococcus lutetiensis
Pathway
slu00473  D-Alanine metabolism
slu00550  Peptidoglycan biosynthesis
slu01100  Metabolic pathways
slu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:slu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    KE3_0608
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    KE3_0608
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    KE3_0608
Enzymes [BR:slu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     KE3_0608
Peptidoglycan biosynthesis and degradation proteins [BR:slu01011]
 Precursor biosynthesis
  Amino acid ligase
   KE3_0608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AGS05116
UniProt: S5RH55
LinkDB All DBs
Position
553352..554398
Genome map
AA seq 348 aa AA seqDB search
MAKETLVLLYGGRSAEREVSVLSAESVMRAINYDKFFVKTYFITKSGDFIKTQEFFSKPA
DDEKLMTNATVVESQKIKPSDIYEEGAVVFPVLHGPMGEDGSVQGFLEVLKMPYVGTNIL
SSSVAMDKISTKHVLESAGVPLVPYVTYVEGSDLDVVVAEVNDKLTYPVFVKPANMGSSV
GISKAEDEAALRSAIDFALKYDSRILIETGVNAREIEVGILGNADVKTTLPGEVVKDVAF
YDYDAKYIDNKITMDIPAHIDSDIMEEMRGYATTAFRAIGGCGLSRCDFFLTEDCHVYLN
ELNTMPGFTQWSMYPRLWENMGLAYPDLIEKLVELAKEMFEKRESHLI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaacgcttgttttactttatggtggacgttctgcggaacgtgaagtatct
gttttatcagctgaaagcgtcatgcgtgcgattaattatgataaattctttgtgaaaact
tacttcatcacaaaatctggtgattttattaaaacacaagaattctttagcaaacctgct
gacgatgaaaaattgatgactaacgccactgttgttgaaagtcaaaaaattaaaccaagt
gatatttatgaagaaggagcagttgttttccctgttcttcatggaccaatgggtgaagat
ggttctgtccaaggtttcttagaagttcttaaaatgccttacgttggaactaacattttg
tcatcaagtgttgcaatggacaaaatttcaacaaaacatgtccttgaatctgcaggagtt
ccacttgttccttacgtgacttatgttgaaggttctgatcttgatgtagtcgtagcagaa
gtaaatgacaaattgacataccctgtctttgttaaaccagctaacatgggttcttcagta
ggtatctcaaaagctgaagatgaagcagcacttcgctcagctattgactttgctcttaaa
tatgatagccgtattcttatcgaaactggtgttaacgctcgagaaatcgaagttggtatt
ttgggaaatgctgacgtgaaaacaacgctccctggtgaagttgttaaggacgttgctttc
tacgattacgatgctaaatacatcgataacaaaattaccatggatattccagctcacatt
gatagcgacattatggaagaaatgcgtggctatgcaacaacagcttttcgtgctatcggt
ggctgcggtttgtcacgttgtgatttcttcttgacagaagattgtcatgtttaccttaac
gaattgaacacaatgcctggtttcacacaatggtcaatgtacccacgtctttgggaaaac
atgggacttgcttacccagatttgattgaaaaattggttgagttggcaaaagagatgttt
gaaaaacgcgaaagccatttgatttaa

DBGET integrated database retrieval system