KEGG   Streptococcus lutetiensis: KE3_1463Help
Entry
KE3_1463          CDS       T02775                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
slu  Streptococcus lutetiensis
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:slu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KE3_1463
  Energy metabolism
   00680 Methane metabolism
    KE3_1463
Enzymes [BR:slu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     KE3_1463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1418287..1421118)
Genome map
AA seq 943 aa AA seqDB search
MKSVTIQKLENNDTQSIITEEVKVLKSLLDETTHQMVGDEVFTKIQNIVELSVSDEYGKL
EELVAQLTNEEMVVVSRYFSILPLLINISEDVDFAYEINYQNNTNQDYLGKLSMTVDMVS
KSENSKEILENVNVVPVLTAHPTQVQRKTVLELTNHIHDLLRKYRDVKAGVVNRDKWYTD
LRRYIEIIMQTDIIREKKLKVKNEITNVMEYYNGSLIQAITKLTSEYKRLAAEKGIDLTN
PKPITMGMWIGGDRDGNPYVTAETLRLSATVQSEVIINYYIEKLTGLYRTFSLSTTLTKI
SPEVERLAELSSDKSIYRENEPYRKAFNYIQSKLIQTLIELKAGPTISRRALENSKLGSD
IYASTNNASVIAKYLQNKVNKVSSELQDEIPSYKTAKEFKDDLLTIKQSLLDNGDDALLT
GDFSELLQAVDVFGFYLATIDMRQDSSVNEACVAELLKSANIVDDYSALSEEEKVKVLLK
ELQEDPRTLSSTNAKKSEQLQKELAIFQTARYLKDKLGDEVIKQHIISHTESVSDMFELA
IMLKEVGLLDNQKARVQIVPLFETIEDLENSRGIMEEFLDYDIVRRWVTANKGYQEIMLG
YSDSNKDGGYLSSVWTLYKAQNELTHIGSERGIKVIFIHGRGGTVGRGGGPSYEAITSQP
FGSIKDRIRLTEQGEIIENKYGNKDVAYYNLEMLLSATVDRIVTRMITNPDEIDTFRETM
DGIVTYSNGVYRDLVFGNPHFYDYFFEATPIKEVSSLNIGSRPAARKTITEISGLRAIPW
VFSWSQSRIMFPGWYGVGSAFKHFIDAKEGNLEKLQHMYEKWPFFHSLLSNVDMVLSKSN
MNIAFQYSKLAESEEVRNVFNIILDEWQLTKDVILAIEKHDNLLEENPSLRASLDYRIPY
FNVLNYIQIELIKRLRHDELDEDYEKIIHTTINGIATGLRNSG
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
gtgaagagtgtgacaatccaaaaactggagaacaatgatacccagtcgatcattaccgag
gaagtcaaagtactaaaaagcttactcgatgaaacaacccatcaaatggttggtgatgag
gtattcactaaaattcaaaacattgttgaattgtcagtaagtgatgaatacggcaaactt
gaagaactagtagctcagttaaccaacgaagagatggttgttgtgtctcgttatttttca
attttgccactgttaatcaacatttctgaagacgttgactttgcttatgaaatcaactac
caaaataatacaaatcaggattatcttggcaaactctctatgactgttgacatggtttca
aaaagcgaaaactctaaagaaatccttgaaaacgtaaatgttgtacctgtcttgactgct
cacccaacacaagttcaacgtaaaacggttcttgaattaacaaaccatattcacgacctt
ttgcgtaaatatcgtgatgtgaaagcaggagtagttaatcgcgataaatggtacactgac
ttacgccgttacattgaaatcatcatgcaaacggacatcattcgtgagaaaaaacttaag
gtaaaaaatgaaattaccaatgtaatggaatattacaatggatccttaattcaagcgatt
actaagttgacgtcagagtacaaacgcttggctgctgaaaaaggtatcgacctaacaaat
ccaaaacctatcacaatgggtatgtggattggtggtgaccgtgatggtaacccatacgta
actgctgaaactcttcgtttgtcagctactgttcaaagtgaagtgatcatcaattactac
attgaaaaattgacaggtctttatcgcacattctcactttcaacaacgttgactaaaatc
agccctgaagttgaacgtttggcagaattatcaagcgataaatcaatttatcgtgaaaac
gaaccataccgtaaagctttcaactacatccaatcaaaattgattcaaacattgattgaa
ttgaaagctggtccaactatttcacgtcgtgcacttgaaaatagtaaacttggttcagac
atttacgcaagcactaacaacgcaagtgttattgctaaatatttgcaaaacaaagttaat
aaagtttcatcagaacttcaagatgaaattccaagttataaaactgctaaagaatttaaa
gacgacttgctcaccatcaaacaatcattgcttgataatggagatgatgctctcttgaca
ggtgactttagcgagttgcttcaagctgttgatgtctttggtttctaccttgcaacaatc
gatatgcgccaagattcaagcgtcaatgaagcttgtgtcgcagaattgttgaaatcagca
aatatcgttgatgattacagcgctctttctgaagaagaaaaagttaaagtccttcttaaa
gaattgcaagaagacccacgtacattgtcatcaacaaatgctaaaaaatcagaacaactt
caaaaagaattggctatcttccaaacagctcgttaccttaaagataaattaggtgatgaa
gttatcaaacaacacattatttcacacaccgaaagtgtttctgatatgtttgaattagct
atcatgcttaaagaagttggacttcttgataatcaaaaagcgcgtgttcaaatcgtgcca
ctttttgaaactatcgaagaccttgaaaactcacgtggtatcatggaagaattccttgat
tatgatatcgttcgtcgttgggttacagctaacaaaggttaccaagaaatcatgcttggt
tactcagatagtaacaaagatggtggttacttatcatctgtatggacactttacaaagct
caaaatgaattgactcatatcggttcagaacgtggtattaaagtgatatttatccatggt
cgtggtggtactgtcggtcgtggtggtggtccatcatatgaagcaatcacatcacaacca
tttggttctattaaagaccgcattcgtttgacagaacaaggtgaaatcatcgaaaacaaa
tacggtaataaagacgttgcttactacaaccttgaaatgttgctttcagcgacagttgac
cgtatcgttactcgtatgattacaaatccagatgaaatcgatactttccgtgaaacaatg
gatggcattgtgacatactcaaatggtgtttaccgtgacttggtatttggtaatccacat
ttctacgattacttcttcgaagctactccaattaaagaagtatcaagcttgaacattggt
tcacgtccagctgctcgtaagacaatcacagaaatctctggtcttcgtgcaattccttgg
gtattctcatggtcacaaagtcgcatcatgttcccgggatggtatggtgttggttcagcc
ttcaaacatttcatcgatgctaaagaaggaaaccttgaaaaacttcaacacatgtatgaa
aaatggccattcttccattcacttctttcaaatgtagacatggtattgtctaaatcaaat
atgaatattgctttccaatattctaaattggcagaaagtgaagaagttcgtaatgtcttc
aatattattcttgacgaatggcaattgacaaaagatgttatcttggcaattgaaaaacac
gataacttgttggaagaaaatccatcacttcgcgcaagtttggattaccgtatcccatac
tttaacgttttgaactacattcaaattgaattaattaaacgtttgcgccatgatgagttg
gacgaagattacgaaaaaatcattcacactacaattaacggtattgccacaggattacgt
aattctggttga

DBGET integrated database retrieval system