KEGG   Solanum lycopersicum (tomato): 100147722Help
Entry
100147722         CDS       T02665                                 

Gene name
GAD2, LeGAD2
Definition
(RefSeq) glutamate decarboxylase isoform2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00250  Alanine, aspartate and glutamate metabolism
sly00410  beta-Alanine metabolism
sly00430  Taurine and hypotaurine metabolism
sly00650  Butanoate metabolism
sly01100  Metabolic pathways
sly01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    100147722 (GAD2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100147722 (GAD2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100147722 (GAD2)
   00430 Taurine and hypotaurine metabolism
    100147722 (GAD2)
Enzymes [BR:sly01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100147722 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Met_gamma_lyase
Motif
Other DBs
NCBI-GeneID: 100147722
NCBI-ProteinID: NP_001233822
UniProt: B1Q3F1
LinkDB All DBs
Position
11
AA seq 503 aa AA seqDB search
MVLSKIASESDVSVHSTFASRYVRTSLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLMMDSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLEDGETAVG
VGTVGSSEAIMLAGLAFKRKWQNKMKAQGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLTDGYYVMSPEKAVEMVDENTICVAAILGSTLNGEFEDVKKLNDLLIEKNKETGWDTP
IHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPDEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYKNVMENCQENARVLREGLEK
TGRFEIVSKEVGVPLVAFSLKDNSKHDEFEISETLRRFGWIVPAYTMPPDAQHITVLRVV
IREDFSRTLAERLVMDIVKVLHELDMLPARVKAKLAVAEEAAAANGIDSVAHHKTDREWE
LQVTEAWKKFVADKKKNKTMGVC
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggttctgtccaagatagcatcggaaagtgacgtgtccgttcactcgactttcgcgtct
cgatatgttcgaacttctcttccaaggtttaagatgccagaaaattcaataccaaaggaa
gcagcctatcaaattataaatgatgaacttatgttagatggaaatccaaggttgaatttg
gcatcttttgtgacaacatggatggaaccagaatgtgacaaattgatgatggattccatt
aacaaaaattatgttgacatggatgaatatcctgtcaccactgagcttcagaatcggtgt
gtaaacatgatagcgcatttatttaatgcaccacttgaagatggagaaactgcagttgga
gttggaacagttggttcttcagaagccattatgcttgctggattggcctttaagagaaaa
tggcaaaacaaaatgaaagcccaaggaaagccctatgataagcccaacattgttactggt
gctaatgtccaggtgtgttgggaaaaatttgcaaggtattttgaagttgagctaaaagaa
gtgaagttgactgatggatactatgtgatgagccctgagaaagctgtggaaatggttgat
gagaacacaatttgtgtagctgctattttgggttcaactcttaatggagaatttgaagat
gtaaagaaattgaatgacctcttgattgagaagaacaaagaaacagggtgggacactcca
attcatgtggatgcagctagtggtggatttattgcaccatttatatatccagaacttgaa
tgggactttagattgccattagttaaaagtataaatgtgagtggtcacaaatatggtctt
gtttatgctggtattggttgggtcatttggaggaacaaagaagacttgcctgatgaactt
atttttcatattaattatcttggtgctgatcaacctactttcaccctcaatttctctaaa
ggatcaagtcaagtaattgctcaatattatcaacttattcgtttgggttatgagggttac
aagaatgttatggagaattgtcaagaaaatgcaagggtactaagagaaggactcgaaaag
acgggaagatttgagatagtctccaaagaagttggagttcccttggttgcattttctctt
aaagacaatagcaaacatgatgagtttgaaatttctgaaactttaaggagatttggatgg
attgttccagcatacactatgccaccagatgctcaacacatcacagttcttagagttgtt
attagagaagatttctccagaacactcgcggagcgactggttatggacatcgttaaagtc
ctccacgagctcgacatgcttccagcacgtgtcaaagctaagctcgccgtggccgaggag
gcggccgcggcgaacggtatcgacagcgtggcacatcataaaacggatagagaatgggag
ttacaggttactgaagcatggaagaagtttgttgctgataaaaagaagaataagactatg
ggagtttgttaa

DBGET integrated database retrieval system