KEGG   Solanum lycopersicum (tomato): 101248407Help
Entry
101248407         CDS       T02665                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase-like
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Pyruvate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
C4-dicarboxylic acid cycle, NAD - malic enzyme type
C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    101248407
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101248407
Enzymes [BR:sly01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     101248407
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
7
AA seq 964 aa AA seqDB search
MSRKIEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQDCY
ELSAEYEGKHDPHKLEELGSMLTSLDAGDSIVVTKAFSNMLNLGNLAEEVQIAYRRRSKL
KKRDFSDEASALTESDIEETFKKLVGQLNKSPQEVFDALKNQTVDLVLTAHPTQSVRRSL
LQKHARIRDCMTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMS
YFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRD
VCLLARMMAANLYFSQIEDLMFELSMWRCNDELRVRAEELHRTSKRDAKHYIEFWKKIPP
NEPYRVLLADVRDRLYNTQERARQLLANGYSDVPEESTFTNLEQFLEPLELCYRSLCACG
DRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDVITRHVGVGSYKEWSEEKRQ
EWLLSELSGKRPLFGPDLPKTDEVADVLDTFHVISELPADSFGAYIISMATAPSDVLAVE
LLQRECHVKSPLRVVPLFEKLADLESAPASVARLFSIDWYRNRINGKQEVMIGYSDSGKD
AGRLSAAWQLYKAQEELVKVAKEFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHGS
LRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMNPPVAPNPEWRALLDEMSVVATKE
YRSLVFQDPRFVEYFRLATPELEYGRMNIGSRPAKRKPSGGIESLRAIPWIFAWTQTRFH
LPVWLGFGAAFKHVIEKDIRNLQMLKDMYNGWPFFRVTLDLLEMVFAKGDPGIAALYDKL
LVSEDLWPLGERLRSKYEETKGFLLQVAGHKDLLEGDPYLRQRLKLRDSYITTLNVSQAY
TLKRIRDPNYNVKVRPHLDKEIMESSKPAAELVKLNPTSEYAPGLEDTLILTMKGIAAGM
QNTG
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atgagtcggaaaattgagaaaatggcttcaattgatgcccaattgaggctattggcacca
gcgaaagtgtcagaggatgataagcttgtggagtatgatgctttgttgcttgacagattt
cttgatattctgcaggatttgcatggagaggatattcgagaaacggttcaagattgttat
gaactatctgctgaatatgaagggaaacatgacccacataagttggaagagcttgggagt
atgcttaccagtttggatgctggggattccattgtagtcaccaaagccttttctaacatg
cttaacttgggtaaccttgctgaagaggttcagatagcttacagacgaagaagtaagcta
aaaaagcgtgatttttcggatgaggcttctgcactaactgaatcagacattgaagagact
tttaagaagctcgtcggacagctaaacaaatcaccccaagaagtttttgatgctttgaag
aaccagaccgtggacttggtgctaacagcacatcctacccagtctgttcgtaggtctttg
cttcaaaagcatgcaaggattcgtgattgtatgacgcagttgtacgccaaagatattact
cctgatgataagcaggagctagacgaggctctacaaagagagatacaagcagcctttcgc
acagatgaaatcaggaggactccaccaactccacaagatgagatgagggcggggatgagt
tacttccatgagacaatatggaagggagtgccgaaattcctacgccgtgttgacactgct
ttgaagaatattggaataaatgaacgtgttccctacaatgcccctctcattcagttctct
tcttggatgggtggtgatcgagatggcaaccctagagtaaccccggaagtgacaagagat
gtgtgcttattggctagaatgatggctgcaaatctgtatttctctcagattgaggatctt
atgtttgagctttcaatgtggcgatgcaatgatgagctccgtgtccgtgcagaagaactt
cataggacttccaaaagagatgcaaagcactacattgaattttggaagaaaattccaccg
aatgagccctaccgtgttcttcttgctgatgtgagagataggttatataatacacaggaa
cgagctcgtcagttactagccaatgggtattctgatgttcctgaggagtcgacattcaca
aatcttgaacagtttctggaacctctggagctgtgctatagatctctatgcgcttgtggt
gacagaccaattgcagatggaagccttcttgattttttaaggcaagtgtccacctttggt
ctgtcgcttgtgagacttgatattcggcaagagtcagatagacacactgatgttctagat
gttataacaaggcacgtgggtgttggctcctataaagaatggtctgaagagaagagacag
gaatggctcttatctgaactaagtggcaagcgtccactttttggacctgatctccctaaa
actgatgaagtcgctgatgttttggatacctttcatgtcatctccgaacttcccgccgac
agtttcggtgcttatataatttcgatggccacggcaccctctgatgtgcttgctgttgag
cttttgcagcgtgaatgtcatgtaaaaagtccattgagggttgttccgttgtttgaaaag
cttgctgatctcgagtctgcacctgcttctgttgctcggttgttctccatagattggtac
agaaaccgtatcaatgggaaacaagaagttatgattgggtattctgattccggtaaggat
gctggccgactatctgcagcttggcaattgtacaaggctcaagaggaacttgtaaaggtg
gcaaaagaatttggagtaaagctaacaatgttccatggccgaggtgggactgtaggaagg
ggagggggtcccacccaccttgctattttatcacaacccccagacacaattcatggctca
cttcgtgtgactgttcaaggtgaagttattgaacagtcatttggggaggaacacctgtgc
tttagaactcttcagcgtttcacagcagctacacttgagcatggaatgaacccccctgtg
gctcctaatccagagtggcgtgccctcttggatgagatgtctgttgttgctacgaaagag
tatcggtctttagtgttccaggatccacgatttgttgaatacttccgccttgcaacccca
gaattagaatatggtcgcatgaacattggaagtcgcccagccaaaaggaagccaagtggt
gggattgaatctcttcgagctattccatggatctttgcatggactcagacaaggtttcat
ctcccagtctggcttggctttggggctgcattcaagcacgttattgagaaggatataaga
aatctgcaaatgctcaaggatatgtacaatggatggcctttctttagagtgacacttgac
ttgctcgaaatggtcttcgctaagggagaccctggtattgctgcattgtatgataaactt
ttagtatccgaagatctgtggccgcttggagagcgattgagatccaaatacgaagaaaca
aagggctttctccttcaggttgctgggcacaaggatctattggaaggagatccatacttg
aggcaaaggctcaaacttcgtgattcttacatcacgacccttaacgtaagccaagcatac
acattgaaacgaattcgtgaccccaactacaatgtgaaggtcagacctcacctagacaag
gagatcatggaatcaagcaaaccagctgctgaattagtgaagctgaatcctacgagcgag
tatgcgcctggcttggaagacaccctcatcttgaccatgaaaggtattgctgctggaatg
cagaacactggttaa

DBGET integrated database retrieval system