KEGG   Solanum lycopersicum (tomato): 101257875Help
Entry
101257875         CDS       T02665                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00630  Glyoxylate and dicarboxylate metabolism
sly00710  Carbon fixation in photosynthetic organisms
sly01100  Metabolic pathways
sly01200  Carbon metabolism
Module
sly_M00165  Reductive pentose phosphate cycle (Calvin cycle)
sly_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
sly_M00532  Photorespiration
sly_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    101257875
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101257875
Enzymes [BR:sly01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     101257875
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small Swm2
Motif
Other DBs
NCBI-GeneID: 101257875
NCBI-ProteinID: XP_004243079
UniProt: K4CCK9
LinkDB All DBs
Position
7
AA seq 169 aa AA seqDB search
MSVSSFVAPIVGSTYLGLKSNRSNFFPAVKDTITWSRKTISNGSKTYCMKSWNPIDNKKF
ETLSYLPPQSEESIAKEVDYIIKKGWVPCLEFDQVGYVHRENSKMPGYYDGRYWTLWKLP
MFGCNDSSQVLNEIQECKKAYPNAFIRCLAFDNVKQAQCMAFLIQKPAP
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtctcaagttttgtagctccaattgttggatcaacttatcttggtttaaaatca
aatagatccaacttttttcctgctgttaaggatacaattacttggagtagaaaaactatc
tccaatggctctaaaacttactgcatgaagtcttggaatcctattgacaataagaagttt
gagacactatcatatcttccacctcaatcagaggagtccattgcaaaggaggttgattac
ataatcaaaaagggttgggttccttgccttgaatttgaccaggtgggatatgtgcatagg
gaaaatagcaaaatgccaggctactatgatgggagatattggacactgtggaagttgccc
atgtttggctgcaatgactcttcccaggttctcaatgaaatccaagaatgcaagaaagct
tacccaaatgcttttattcgttgcttggcgtttgataatgttaagcaggcacagtgcatg
gccttcctcattcagaaacctgcaccataa

DBGET integrated database retrieval system