KEGG   Solanum lycopersicum (tomato): 101257875Help
Entry
101257875         CDS       T02665                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512-like
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    101257875
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101257875
Enzymes [BR:sly01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     101257875
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
7
AA seq 169 aa AA seqDB search
MSVSSFVAPIVGSTYLGLKSNRSNFFPAVKDTITWSRKTISNGSKTYCMKSWNPIDNKKF
ETLSYLPPQSEESIAKEVDYIIKKGWVPCLEFDQVGYVHRENSKMPGYYDGRYWTLWKLP
MFGCNDSSQVLNEIQECKKAYPNAFIRCLAFDNVKQAQCMAFLIQKPAP
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtctcaagttttgtagctccaattgttggatcaacttatcttggtttaaaatca
aatagatccaacttttttcctgctgttaaggatacaattacttggagtagaaaaactatc
tccaatggctctaaaacttactgcatgaagtcttggaatcctattgacaataagaagttt
gagacactatcatatcttccacctcaatcagaggagtccattgcaaaggaggttgattac
ataatcaaaaagggttgggttccttgccttgaatttgaccaggtgggatatgtgcatagg
gaaaatagcaaaatgccaggctactatgatgggagatattggacactgtggaagttgccc
atgtttggctgcaatgactcttcccaggttctcaatgaaatccaagaatgcaagaaagct
tacccaaatgcttttattcgttgcttggcgtttgataatgttaagcaggcacagtgcatg
gccttcctcattcagaaacctgcaccataa

DBGET integrated database retrieval system