KEGG   Solanum lycopersicum (tomato): 544054Help
Entry
544054            CDS       T02665                                 

Gene name
SODCC.1, SODCC.5, SODCC2, Sod
Definition
(RefSeq) superoxide dismutase [Cu-Zn] 1
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:sly00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    544054 (SODCC.1)
Enzymes [BR:sly01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     544054 (SODCC.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1
AA seq 152 aa AA seqDB search
MVKAVAVLNSSEGVSGTILFTQDGDAPTTVNGNISGLKPGLHGFHVHALGDTTNGCMSTG
PHYNPAGKEHGAPEDEVRHAGDLGNITVGEDGTASFTITDKQIPLTGPQSIIGRAVVVHA
DPDDLGKGGHELSKSTGNAGGRIACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggccgtcgccgtccttaacagcagtgaaggtgttagtggcaccatcctcttc
actcaagatggagatgctccaaccacagttaatggaaatatttctggcctaaaacctgga
cttcatggcttccatgtccatgcccttggtgataccacaaatggctgtatgtcaacagga
ccacattacaatcctgctggtaaggagcatggtgctcctgaagatgaggtgcgtcatgct
ggtgatcttggtaacatcacagttggagaagatggtactgcatcttttactattaccgac
aagcagattcctctcactggtccacagtccatcattggaagagctgttgttgttcatgct
gatcctgatgatcttggaaagggaggacatgagctcagtaaaagcaccggaaatgctggc
ggaaggattgcttgtggtattattggcctccagggttaa

DBGET integrated database retrieval system