KEGG   Solanum lycopersicum (tomato): 778210Help
Entry
778210            CDS       T02665                                 

Gene name
HXK3
Definition
(RefSeq) hexokinase
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sly00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    778210 (HXK3)
   00051 Fructose and mannose metabolism
    778210 (HXK3)
   00052 Galactose metabolism
    778210 (HXK3)
   00500 Starch and sucrose metabolism
    778210 (HXK3)
   00520 Amino sugar and nucleotide sugar metabolism
    778210 (HXK3)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    778210 (HXK3)
Enzymes [BR:sly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     778210 (HXK3)
Membrane trafficking [BR:sly04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    778210 (HXK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
12
AA seq 499 aa AA seqDB search
MGKLVVGATVVCTAAVVCGVTVLLMKHRVKNSGEWGKVEALLKDFEEKCATPVEKLKQVA
DAMTVEMQAGLASEGGSKLKMLISYVDNLPTGDEKGLFYALDLGGTNFRVMRVQLGGKEK
RIVKHEVKEVSIPQNVMTGSSSEVLFDFIATALAEFVATEGDDFHLPPGRQRELGFTFSF
PVKQLSIASGTLIKWTKGFSIEDLVGQDVVGELAKAMERAGLDVRVAALVNDTVGTLAGG
RYNNPDVIAAVILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFRSSHLPVTEY
DQNLDIESLNPGEQIYEKIISGMYLGEILRRVLCRMAEEASLFGDYVPSKLKVPFVLRTP
DMAAMHHDESADLKVVGNKLKDILEVPNSTLKMRKIVVELCDIITSRGARLSAAGIVGIL
KKLGRDTFKDGEKQRSVIAVDGALFEHYTKFRNCLKETMKELLGDAADSTVIELSNDGSG
VGAALLAASHSQYTDLEES
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaattggttgtaggtgcaacagttgtgtgtactgctgctgtagtatgtggggtg
acagttttgttaatgaaacatagggtgaagaattctggggagtggggaaaagttgaagct
ttattgaaagattttgaggagaagtgtgcaactccagtggaaaaattaaagcaggtagct
gatgctatgactgtagagatgcaagctggacttgcttctgaaggtgggagtaagctcaag
atgcttattagctatgttgataaccttcctactggggatgaaaaaggtctgttttatgca
ttggatctaggcggcacaaactttcgagtgatgcgtgtacagttgggtgggaaagaaaag
cgtatagttaaacatgaagttaaagaagtttcaattccacagaatgtgatgactggatca
tcatctgaagtgttatttgattttattgccacggcacttgcagaatttgtagctacagaa
ggtgatgattttcatcttccacctggtagacaaagggagttaggctttaccttctctttc
cctgtgaaacaattgtcaattgcatcaggaactcttattaaatggacaaagggcttctcc
atagaagatttggttgggcaagatgtggttggagaattagcaaaagcaatggaaagggcc
ggccttgacgtgcgtgtggctgcattagtaaatgatactgttggaacgttagcgggaggt
cggtacaataatcctgatgtcattgctgcagtaattttgggtaccggaaccaatgcagca
tatgttgaacgggctcatgcgattcccaaatggcatggtctgttgcctaaatccggagaa
atggttatcaacatggaatggggtaatttccgctcatcacatcttccagtaacagaatat
gaccaaaatcttgatattgagagtttaaaccccggtgagcagatttatgaaaagattatt
tccgggatgtatcttggagaaattttgcgtagagtattgtgtagaatggctgaagaagct
tcattattcggtgattatgtcccatccaaactgaaagttcctttcgtattgaggactccg
gacatggctgctatgcatcacgacgagtctgctgatctcaaggttgttggaaataagctg
aaggatatcttagaggtacctaattctaccttgaaaatgaggaaaatagttgtggagctg
tgcgatattatcacctctcgtggagctcgtctttctgcagcaggaattgtgggcatcctc
aagaaattgggaagagacacttttaaagacggagagaagcagaggtctgtcatagctgtg
gacggtgcattgtttgagcattacaccaagttcagaaattgcttgaaggaaactatgaaa
gagttactgggagatgctgcagatagcacagtcattgagctttctaatgatggttcaggc
gttggagctgcacttttggctgcctcacattcccaatacacagatctcgaggaatcttga

DBGET integrated database retrieval system