KEGG   Serratia marcescens subsp. marcescens Db11: SMDB11_1484Help
Entry
SMDB11_1484       CDS       T03985                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase, Cu, Zn
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
smac  Serratia marcescens subsp. marcescens Db11
Brite
Enzymes [BR:smac01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SMDB11_1484 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1552281..1552805
Genome map
AA seq 174 aa AA seqDB search
MMKRYWYAALGLMACGAAQAATADVEMHLVTGQGIGQDIGKVVISETPYGLLFTPSLKAL
PAGVHGFHVHEKGSCEPGMKEGKAVAALAAGGHFDPQKTGKHLGPYADGHLGDLPAIYVT
ADGMANYPVLAPRLKKISEIEGKALMVHAGGDNHSDHPQPLGGGGERFACGVVK
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
ttgatgaaacgttattggtatgcggcgctcggcttgatggcgtgtggcgcggctcaggcg
gcgacagctgacgttgagatgcatctggtgaccgggcagggtatcggtcaggatatcggc
aaggtagtcatcagcgaaacgccgtatggcttactgttcacgccgagcctgaaagcgttg
ccggccggagtacacggtttccacgtgcatgaaaaaggcagctgcgagccgggcatgaag
gaaggtaaagcggtggcggcgctggcggccggcggacatttcgacccgcaaaagaccggg
aaacacctcgggccgtacgccgacgggcacctgggggatttgccggccatctatgtgacc
gccgacggcatggcaaactacccggtgctggccccgcggctgaaaaaaatcagcgaaata
gagggcaaggcgctgatggtgcacgccggcggcgataaccattcggatcatccacagccg
ctcggcggcggcggcgaacgcttcgcctgcggcgtggtcaagtga

DBGET integrated database retrieval system