KEGG   Serratia marcescens FGI94: D781_4357Help
Entry
D781_4357         CDS       T02433                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
smaf  Serratia marcescens FGI94
Pathway
smaf00564  Glycerophospholipid metabolism
smaf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smaf00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    D781_4357
Enzymes [BR:smaf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     D781_4357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 Pyr_redox_2 3HCDH_N FAD_oxidored Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: AGB84533
UniProt: L0MKY1
LinkDB All DBs
Position
4586139..4587647
Genome map
AA seq 502 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRTGLFLYDHLGKRTSLPGS
KSLRFGPESVLKPELKRGFEYSDCWVDDARLVVLNAQEVVERGGEVRTRTKVTRAWRENG
MWMVEATDIDSGKTFTWRAKGLVNATGPWVKNFFDDGLKLKSPYGIRLIKGSHIVVPKAH
NQPQSYILQNEDNRIVFVIPWMDEFSIIGTTDVEYHGDPKDVKIDDNEINYLLKVYNDHF
KKQYGRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDVHDDNGQAPLLSVFGGKLTTYRK
LAEHAMEKLARYYPEAGPAWTKNGTLPGGDIGGDRDSYAAKLRREHGWLPEALARRYART
YGSHSELILSGANSLADLGEDFGHGLYEAELRYLVEKEWVVELKDAIWRRTKLGMWLDEA
QQARVSEWLAERAKAKALSLAS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacttgatcgttatcggtggcggcatcaacggtgccggcatcgcggcg
gatgctgccgggcgcgggctgtccgtactgctactggaagcgcaagacttggcctgtgct
acgtcttccgccagttccaaactgatccacggcggcctgcgctacctggaacactacgaa
ttccgtctggtcagcgaggcgctggcggaacgtgaagtgctgctgaaactggcgccgcat
atcgccttcccgatgcgcttccgcctgccgcaccagccgcacctgcgtccggcctggatg
atccgtaccggcctgttcctgtacgatcacctgggcaagcgcaccagcctgccgggcagc
aagagtttgcgttttggcccagaatccgttctgaagccggaactgaagcgcggtttcgaa
tattccgactgctgggtcgacgatgcgcgtctggtagtactgaacgcgcaggaagtggtg
gaacgcggcggcgaagtgcgcacccgcaccaaagtgacccgcgcatggcgtgaaaacggc
atgtggatggtggaagcgaccgatatcgacagcggcaaaaccttcacctggcgcgccaaa
ggtctggtcaacgccaccggcccgtgggtgaaaaacttcttcgacgacggcctcaagctg
aaatccccgtacggcatccgcctgatcaaaggcagccatatcgtggtgccgaaggcgcat
aaccagccgcagtcgtacattctgcagaacgaagacaaccgtatcgtcttcgtaatcccg
tggatggatgagttctcgattatcggcaccaccgacgtggaatatcacggcgatccgaaa
gacgtgaaaattgacgataacgaaatcaattacctgctgaaagtgtacaacgaccacttt
aagaagcagtatggccgcgacgatatcgtctggacctactccggcgtgcgtccgctgtgc
gacgatgagtccgactcaccgcaggccatcacccgtgactacacgctggacgtgcacgac
gacaacggccaggcgccgctgctgtcggtctttggcggtaagctgaccacctaccgtaag
ctggcggaacacgcgatggaaaaactggcgcgttactatccggaagccggccctgcctgg
accaaaaacggcaccctgccgggcggcgatatcggcggcgaccgcgacagctacgcagcc
aaactgcgccgtgaacacggctggctgccggaagcactggcgcgtcgctatgcccgcacc
tacggcagccacagcgagctgatcctgtccggcgccaacagcctggcggatctgggcgaa
gacttcggtcacggcctgtacgaagcggagctgcgctacctggtggagaaagagtgggtg
gtggagctgaaagacgctatctggcgccgcaccaagctcggcatgtggctggacgaggcg
cagcaggcgcgcgtcagcgagtggctggcggaacgcgcaaaagccaaagcgctgtcgctg
gcttcctaa

DBGET integrated database retrieval system