Streptomyces malaysiensis: SMALA_5141 Help Entry SMALA_5141        CDS       T05189                                  Name (GenBank) glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism smal  Streptomyces malaysiensis Brite KEGG Orthology (KO) [BR:smal00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     SMALA_5141 Enzymes [BR:smal01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      SMALA_5141 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 GST_N_2 Thioredoxin Glrx-like GST_N_3 IU_nuc_hydro Motif Other DBs NCBI-ProteinID:  ATL85371 UniProt:  A0A291SX12 LinkDB All DBs Position complement(6341854..6342096) Genome browser AA seq 80 aa AA seqDB search MSGTVTMYSTTWCGYCRRLKGQMDREGITYTEINIEQDPESAAFVEKANGGNQTVPTVLF PDGSTLTNPSLAQVKAKVGV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtccggcactgtgacgatgtacagcaccacctggtgcggctactgccgccgcctgaag ggccagatggaccgcgagggcatcacctacaccgagatcaacatcgagcaggacccggag tcggccgccttcgtcgagaaggcgaacggcggcaaccagacggtgccgaccgttctcttc cccgatggatcgaccctgaccaacccgtcccttgcgcaggtcaaggccaaggtcggggtc tga

DBGET integrated database retrieval system