KEGG   Serratia marcescens SM39: SM39_2178Help
Entry
SM39_2178         CDS       T03592                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase/deoxyuridine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
smar  Serratia marcescens SM39
Pathway
smar00240  Pyrimidine metabolism
smar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smar00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SM39_2178 (tdk)
Enzymes [BR:smar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SM39_2178 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 KdpD AAA_30
Motif
Other DBs
NCBI-ProteinID: BAO34197
LinkDB All DBs
Position
complement(2247392..2247976)
Genome map
AA seq 194 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTLVFTAEIDHRFGVGKVSSRIGLSSQAQ
LYNNDSMLYAMIQQEHQQQPVHCVLLDESQFLTKAQVEQLCDVVDQLDIPVLCYGLRTDF
LGELFIGSQYLLAWADKLVELKTICHCGRKANMVLRLDENGQAMHAGEQVVIGGNESYVS
VCRKHYKEAIHSLE
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggctcaactttatttttattactctgcgatgaatgccggcaagtccaccgcgctgcta
cagtcttcatataactatcaagaacgtggtatgcgcacgctggtgttcaccgcggagatc
gatcaccgctttggggtaggcaaagtcagctcgcgcatcggtttatcctcgcaggcccag
ctctataacaacgactcgatgctgtacgccatgattcagcaggagcatcaacagcagccg
gtgcattgcgtgctgctggatgaaagccagttcctgaccaaggcccaggttgagcaattg
tgcgatgtggtggaccaactggacattcccgtattgtgctacggcctgcgtaccgatttt
ctcggtgagctgtttatcggcagccaatatttgctggcctgggctgataagctggtggaa
ttgaaaaccatctgccactgcgggcgcaaagccaatatggtgttgcggttggatgaaaac
ggccaggcgatgcacgccggtgagcaggtggtgattggcggtaacgagagctatgtctcc
gtctgccgcaagcattataaagaagcgattcactccctggagtag

DBGET integrated database retrieval system