KEGG   Streptococcus mitis: smi_0601Help
Entry
smi_0601          CDS       T01173                                 

Gene name
nanA
Definition
(RefSeq) sialidase A (neuraminidase A)
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
smb  Streptococcus mitis
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:smb00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    smi_0601 (nanA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    smi_0601 (nanA)
Enzymes [BR:smb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     smi_0601 (nanA)
Bacterial toxins [BR:smb02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   smi_0601 (nanA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
539336..545059
Genome map
AA seq 1907 aa AA seqDB search
MFIRLKGLGKFRKSKAYGLVGCLTLFAVLGLAAPELPVIGGGVAYADVIQGGNDIKDVEV
HSDAANGVAMTYTTYDSGNSGQQTASGSGVFVAPNVMVTAAHNYYEKKTEDGSAVLRGGD
SAKSYVVMNSDTEKINKVPTSGSTEAVAKESIHAYNEKDFGKSYGNDLAVVVTNKTVEAM
TNGEDSPRELSKTEVATGDSIRMVGYPNDFSTSNLSEENRNRLKDGKPYEVEGKVSTLNK
ENGAVTYHTSALGGFSGAPLFNDKGEVVGIHQHGTNTASEVEANRIGGGTIFTEKHKEWI
RSMVDRYAITGWYLDGTIRYYYDENHKALKNVEKEIDGARYRFNDRGQATLLSGVEKGRV
LLRLEDVKGNRLIADKVVQTGEVDSPIVFNLRQDSDFNRLVGDSPNAKIVSYNNLPINKL
VTDTSWSGDYVSKVALGNTVIKAVLDSVAPKTDFARTEVGKVDLSGTANLPKPSEIVKNA
PNGEQNFQATTHILTPDGTGSATLIAPNLLLTVAHNFLTVNGSKVVTKSGKENTVYKATL
PNGTSINFSDEEIAYWNRAESVFGFKNDLALVRLKEAVQGVTPVEVVKQSAKVAEGNTVS
VYGFPDNKLSPVLDSKVVGTTDFGSGIEGISYGGTKPGASGGGLYNDKGVLIGVHQNGVV
DNRSGGLVLSKEQLDWVRSYIEGQPKEPVYVKDKEVASSKQDLDKELAEKLASATDNGVE
INKESLKEEKPTNQEGNSENVPAEPNVEKGEKTENLPEEVESADNVVLPPRDYFARDLKN
VKTVFEKEDLATNAGNGQRVDLAEALDKLKHLQNATIHMEFKPDANAPQFYNLFSVSSDK
NRDEYFSMSVNKGTAMVEARGADGSHFYGSYSDAPLKVKPGKWNSVTFTVERPKADQPNG
QVRLYVNGVLSRTNTKSGRFIKDMPDVNKIQIGATRRANQTMWGSNLQVRNLTIYDRALT
SEEVGKRSQLFKVADLEVKLPESAKITEKKEVFVSGVNGGLNKDGINTYRIPALLKTDKG
TLIAGADERRLQFADWGDIGMVVRRSQDGGETWGDRITISNLRDNPDAKDKTAPSPLNID
MVLVQDPETKRIFSVYDMFPEGKAVFGMPAKPEKAYERIGDKTYQILYKTGEKGYYTIRE
NGEVYNSKNQKTDYHVVVNPKKLGYSDKGDLYKGKDLIGNVYFAQSTKNPFKVANTSYLW
MSYSDDDGKTWSAPKDITPGIRQDWMKFLGTGPGTGIVLRTGEHKGRILVPAYTTNSVSH
LGGSQSSRLIYSDDHGVTWHAGEAPNDNRPVGNKTIHSSNMNNGGAQNTESTVLQLNNGD
VKLFMRGLTGDLQVATSKDGGITWEKTIKRYPEVKDAYVQMSAIHTMHDGKEYILLSNAA
GPGRERKDGLVHLARVEKNGELTWIKHHLIQGGEFAYNSLQDLGNGEYGILYEHSENGQN
RYTLSYKKFNWDFLTKDRISPKEVKVKQVSDMGEGIMSLEFDSEVLVNQAPTLSLANGKT
IEFMTQLDNKTLLFAVNKKDIGQEITGIVGGSIESMHDLPVNLRNSGIPGGINSAEVAVN
ELDDYTGAIGTAGEEIATTESLLDYSGGVSSEPVVTPEVDEYSGGVNAVEAAASELDDYT
GAIGTAGEEIATAESLLDYSGGVSSEPVVTPEVDEYSGGVNAVEAAVNELEDYTGLFATP
EETSTVKSTEKQVSNKESKKEEKTNQVIPSLDSSQRLFKNETGSVHIQASEEVLRNVKAV
QIEEVKVSSLSSLNYKAFDIKLKNADGQSVQPKGKVLITFTTDQSVENVYYVDPEGNLHP
LEFTQKDGKVIFGTNHFSIYAMTFRLSVNNLALDNATKDKKEEEIAPLPKLLSTNQHSES
NQSENRVSNNEQTMLPNTGESASLLTILFGFVGVFLGAMISYKRKDS
NT seq 5724 nt NT seq  +upstreamnt  +downstreamnt
atgtttatacgtttaaaaggtttaggaaaattccgtaaatccaaagcttatggtttggtt
ggttgcttgacattattcgcagtgcttggtttagctgcaccagagttaccagttattggc
ggtggagttgcttatgctgatgttattcagggtggtaacgatataaaagatgtagaagtt
catagcgatgctgctaatggtgtagcgatgacctataccacctatgatagtggtaatagt
ggtcaacaaacagcatcaggtagcggagtatttgttgcaccaaatgtgatggtgactgct
gctcataactactacgagaaaaaaactgaagatggctctgcggttttacgtggcggtgat
tctgctaaaagttatgtcgtgatgaattcagatacggagaaaataaataaagttcctacg
tcaggtagtactgaagctgtagctaaagagtctattcatgcatataatgaaaaggatttt
ggaaagtcttacggtaatgacttggcagttgttgtaactaataaaactgttgaagctatg
acaaatggagaggattcaccaagagagctaagtaagactgaggtagctacaggtgattcg
attcgaatggttggctatcccaatgatttttcaacctctaatctaagtgaagaaaacaga
aatcgactaaaagatggaaaaccttatgaagttgaagggaaagtaagtactcttaataaa
gaaaatggtgctgttacttaccatacgtctgctttaggtggtttttcaggtgctccttta
tttaatgataaaggggaagtagttggtatccatcaacacggaacaaatactgctagtgaa
gtagaagctaatcgtatcggtggtggtactatctttacggaaaagcataaagagtggatt
cgttctatggtggatagatatgcaattacgggatggtacctagatggaacgattcgctac
tattatgacgaaaatcataaagctctaaagaatgttgaaaaagaaattgatggtgcgcgc
tatcgtttcaatgatagaggtcaagcaaccttattaagtggagttgaaaaaggtcgagtt
cttcttcgtctggaagatgtgaagggcaatcgcttgattgcagacaaggtagtgcaaaca
ggagaagttgactcaccaatcgtattcaatttacgacaagattcagactttaatcgatta
gtaggtgattctccgaatgctaagatagtgtcttataataatcttcctatcaacaagtta
gttacggatactagttggtctggtgattatgtaagtaaagtggctctaggaaatacggtt
attaaagctgtgttagactcggtagctccaaaaactgattttgctcgtacggaggttggg
aaagttgatttaagtggaactgcaaacttaccaaaaccaagtgaaatagtaaaaaatgca
ccaaatggagaacaaaatttccaagccactacgcatatcttaacacctgatggaacaggt
tcagcaaccttaattgctcctaatttgttattaactgtggcacacaactttttaacagtt
aatggctctaaggttgttacaaagtcagggaaagagaatacagtttataaggctacgtta
ccaaatggaacttctatcaatttttctgatgaagaaattgcttattggaacagagcagag
tctgtttttggctttaaaaatgacttagctctcgttcgattaaaagaagcagtacaagga
gtaactcctgtagaagttgtgaagcaatctgcaaaagttgcagaaggcaatacagtttcg
gtttatggtttcccagataacaagttaagtccagttttagatagtaaagtagtcggaact
actgactttggttctggtatagagggaatcagctatggaggtacgaaacctggagcatca
ggtggtggactatacaatgataaaggtgttttaatcggcgttcatcaaaatggagtggtt
gataatcgtagtggtggcttagttttatcaaaagaacaattagattgggttcgttcctat
attgaaggtcaacccaaagagccagtttatgtgaaagacaaagaagtagcatcatctaaa
caggatttggataaggaactagctgaaaagttggcttcagcaactgacaatggagttgaa
attaacaaggaaagcttgaaagaagagaaacctactaaccaagaaggaaattctgaaaat
gttccagcagagcccaatgtagaaaaaggagaaaaaacagagaatctcccagaagaagtt
gaaagtgcagataacgttgtacttcctccacgtgattactttgctagagacttgaagaat
gttaaaactgtatttgaaaaagaagaccttgctacgaatgctggaaatgggcaaagagtt
gacttagcagaagccttagataagttgaaacatcttcaaaatgcgactattcatatggag
tttaaaccagatgccaacgctccgcaattctataatcttttctctgtatcaagtgataag
aatagagacgaatatttcagtatgtctgttaataaaggtactgcaatggtagaagctcgc
ggagctgatggaagtcacttttatggaagttattcagatgcaccacttaaagtaaaacct
ggaaaatggaattctgttactttcacagtggaaagaccgaaagcagaccaaccaaatgga
caagttcgtctatatgtaaatggtgtattatctagaacgaatacgaaatctggtcgtttt
attaaagatatgccagatgttaataagattcagattggtgctactagaagagcgaaccaa
acaatgtggggatcaaatcttcaggttcgtaatctgaccatatatgatcgtgccttaacg
tctgaagaagtaggaaaacgcagtcaattatttaaagtagcagatttagaagtgaaattg
ccagaaagtgcaaaaatcacagagaagaaggaagtttttgtaagtggtgtaaatggtgga
ttgaataaggatggaattaatacttaccgaattccagcactgctaaaaacagataaaggc
acattaattgccggagcggatgaaagacgtttacaattcgcagattggggagatattggt
atggtagttcgtcgaagtcaggacggaggagagacgtggggagatagaataacaatttct
aatcttcgtgataatccagatgccaaagacaaaactgctccgtcgccattaaatattgat
atggtattagttcaagatccagaaactaagagaatcttttcggtttatgatatgttccca
gaaggaaaagcagtattcggtatgcctgctaaacctgaaaaagcatacgagcgtataggg
gataaaacttatcaaattttatataaaacaggcgaaaaaggatattataccattcgtgaa
aatggtgaagtttataattctaaaaatcaaaaaacagattaccatgttgtagtaaatccc
aaaaaactaggatatagcgacaaaggtgatttgtataaagggaaggatttaattggtaat
gtttactttgcacaaagtactaaaaatccttttaaagttgcaaatactagctatttatgg
atgtcttatagtgatgatgatggtaaaacttggtctgcaccgaaagatatcacaccaggt
attcgtcaagattggatgaaattccttggaacaggtcctggaacgggtattgtattacgc
acaggtgagcacaaggggcggatattagtacctgcttatacaacaaatagtgtttcacat
ttaggtggttctcaatcttctcgtttgatttactcagatgatcatggagtaacctggcat
gctggagaagcaccaaatgataatcgacctgtaggaaacaagactattcattcatctaac
atgaataatggtggtgcgcaaaatacagaatcaaccgtacttcaattaaataatggagat
gtcaaactcttcatgcgtggattaactggagatcttcaggttgctactagtaaagacggt
gggatcacttgggagaaaacaatcaaacgttatccagaagtaaaagatgcctacgtacaa
atgtcagctattcatacgatgcatgatgggaaagagtacattcttcttagcaatgctgct
ggaccaggccgcgaacgaaaagatggtttagtccatttggcacgtgttgagaagaacggc
gagttgacttggataaaacatcatttaattcaaggtggagaatttgcatataattcatta
caagacttgggtaacggagaatacggaattttatatgaacatagcgaaaatggtcaaaat
cgctataccctttcttataagaaatttaattgggacttcttgactaaagatagaatttct
cctaaagaggtaaaagttaaacaagtttctgatatgggtgaaggtataatgagtttagag
tttgattcagaagtattagttaatcaagcacctactttaagtttagctaatggaaaaaca
attgaatttatgactcaattagacaataaaactcttttatttgcagtaaataaaaaagat
attggtcaagaaataactggtatagttggtggtagtatagaaagtatgcacgatttacca
gtaaacttaagaaactcaggaattcctggtgggataaactcagcagaagtagcagtaaat
gaattagatgattatactggagctataggaacagcaggagaagaaatagctaccacagaa
tctcttttagactattcaggaggagtaagttcagaaccagtcgtaaccccagaggtagac
gaatacagcggcggagtgaacgcagtagaagcagcggcaagtgaattagacgattatact
ggagctataggaacagcaggagaagaaatagctaccgcagaatctcttttagattattca
ggaggagtaagttcagaaccagtcgtaaccccagaggtagacgaatacagtggaggagta
aacgcagtagaagcagcggtgaatgaattagaagattatacaggactattcgcaacacca
gaagaaacttcaacagtgaaatctactgagaaacaagtaagtaataaggaaagtaagaaa
gaagaaaaaactaatcaagttatcccaagtcttgacagctcgcaacgtcttttcaaaaat
gaaacaggcagtgttcacattcaagcttcagaagaagttttgagaaatgttaaagctgtt
caaatagaagaagtgaaagttagtagcttaagctcattaaactataaagcatttgatatc
aagttgaagaatgcagatggtcaatcggttcaacctaaaggaaaagttcttattactttt
actacggatcagtctgttgaaaatgtttattatgtagatccagaaggaaatctacatcct
cttgaattcacacaaaaagatggaaaggttatttttggaaccaatcactttagtatttat
gctatgactttccgactctctgttaataatctagcacttgataatgctacaaaagataaa
aaagaagaggagattgcaccattacctaaattgttatctacaaatcaacactcagaatca
aaccaatcagagaatagagtaagtaacaatgaacaaactatgttaccaaatacaggtgag
tctgcttcattactaacaatcttatttggttttgtaggagtgtttcttggagcaatgatt
tcttataagcgaaaagacagttaa

DBGET integrated database retrieval system