KEGG   Streptococcus mutans NN2025: SmuNN2025_1290Help
Entry
SmuNN2025_1290    CDS       T01185                                 

Gene name
capP
Definition
(GenBank) putative phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
smc  Streptococcus mutans NN2025
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:smc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SmuNN2025_1290 (capP)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SmuNN2025_1290 (capP)
  Energy metabolism
   00680 Methane metabolism
    SmuNN2025_1290 (capP)
Enzymes [BR:smc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SmuNN2025_1290 (capP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1361595..1364318)
Genome map
AA seq 907 aa AA seqDB search
MTINKLESRNDKEAIAEEITILTKLLDDATKTMVGSASFDKITLFKKLSIEEKHQELERE
IEQLTNEEMVVVSRYFSILPLLINISEDVNLAYEINYQNNNDIDYLGKLSATIELVSSQK
NAQEILENVNVVPVLTAHPTQVQRKTMLDLTNHIHELLRKYRDVKAGSINKQKWYDDMRR
YVELIMQTDIIREKKLKVTNEITNVMEYYNSSLIKGVTKLITEYKHLSQQKGFDLGNAKP
ITMGMWIGGDRDGNPFVTAETLKISALVQNEVILNYYIDKVSDLYRTFSLSTSLSTISNA
VKEMADRSTDVSIYREKEPYRKAFHYIQSRLQETLIYLKNNHLEELESEDSAQILPYQSA
QEFRNDLQLIKDSLLENNGSAFITGDLTELLQAVDVFGFFLASIDMRQDSSVHETCVAEL
LASANIVANYSDLPEEEKIAILLKELTEDPRILSATHVEKSEILQKELAIFKTARKLKDA
LGEDVIKQHIISHTESISDMFELAIMLKEVGLVDTDKARVQIVPLFETIEDLDNSREIMR
QYLNYDIVKKWIAANHNYQEIMLGYSDSNKDGGYLSSGWALYKAQNELTEIGSDNGVKIT
FFHGRGGTVGRGGGPSYEAITSQPFGSIKDRIRLTEQGEVIGNKYGNKDVAYYNLEMLVS
ATLDRMVTRRIVNSDNLVNYRLIMDEIVADSNLIYRDLVFGNEHFYDYFFAASPIREVSS
LNIGSRPAARKTITEISGLRAIPWVFSWSQNRIMFPGWYGVGSAFKHFIDKDEKNLTKLQ
EMYQSWPFFHSLLSNVDMVLSKSNMNIAFEYAKLCQDEETKEVFATILDEWQLTKNVILA
IESHKQLLEDNSYLKASLDYRLPYFNVLNYIQIELIKRQRRGELGENLENLIHITINGVA
TGLRNSG
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
gtgacaatcaacaaactagaaagtagaaatgataaagaagcaattgctgaggagattact
attcttaccaaactactggacgatgctaccaaaacaatggttggcagtgctagctttgat
aagattactctctttaaaaaattatcaattgaagagaagcatcaagagttagaacgtgaa
attgagcagttaacaaatgaagaaatggtcgttgtttctcgttatttctccattttaccg
cttcttatcaatatttctgaagatgtcaatttagcttatgaaatcaactatcaaaacaat
aatgatattgattatttagggaaattatcagccactattgaacttgtttctagtcaaaaa
aatgctcaagaaattctggaaaatgttaatgttgttcctgttctaacagcgcatccaact
caagtgcagcgaaaaacgatgctggatttaactaatcatattcatgaacttttgcgtaag
taccgtgatgttaaagctggatctattaacaagcaaaaatggtatgacgatatgcgccgt
tatgttgagctcattatgcaaacagatattattcgtgaaaagaaattaaaagtcactaat
gaaattactaatgtcatggaatactataattcctctctgattaagggtgttactaaatta
attacagaatacaagcacttgtctcagcaaaaaggatttgatttaggaaatgctaaacca
attacgatgggaatgtggattggcggtgaccgtgatgggaatcctttcgtcactgctgaa
accctgaaaatatcagctctggtgcaaaatgaagtgattttaaattattatattgacaaa
gtttcagatctttatcgaacattttctctttcaaccagcctttctactattagcaatgca
gttaaagagatggcagatcgttcaacggatgtttcgatttaccgagaaaaagaaccctat
cgtaaggcttttcattatattcaatcaagattgcaagagactcttatttatttaaaaaac
aaccatttagaagagttggagtctgaagatagtgctcaaatccttccttatcaatcagcg
caagagtttagaaatgatttgcaactcatcaaagattctcttttagaaaataacggttct
gcttttattacgggtgatttaacagaattattgcaagcagttgatgtttttggtttcttt
ttagcttctattgatatgcgacaagattccagtgttcacgaaacctgtgtagcagaactg
ttagcttcagccaatattgttgctaactatagcgatttacctgaagaagaaaagattgct
attcttctcaaagaattgactgaagatcctcgaatactgtctgcaacgcatgttgaaaaa
tcggaaatattgcaaaaggaattagctatttttaaaacagctaggaaattgaaggatgct
ctgggagaagatgtgattaaacaacatatcatttcacacacagaaagcatttctgatatg
tttgaattagctatcatgctcaaagaagtcggcttggttgacacagataaggcgcgtgtg
caaattgttcctttatttgaaaccattgaggacttggataattctcgcgaaatcatgaga
cagtatctcaattatgatattgttaaaaaatggattgcagccaatcataattatcaggaa
attatgttgggttactcagattctaacaaggatggtggttatttatcgtctggctgggcg
ctctacaaagcacaaaatgaattgacagaaattggttctgataatggtgtcaaaatcacc
tttttccatggacgcggcggtactgttggacgtggtggcggtccatcttatgaggctatt
acatcacagccatttggttccatcaaggatcggattcgtttaacagaacaaggtgaggtt
attggtaataaatatggcaataaggatgttgcatactacaacctggaaatgctggtttca
gcaactcttgatcgcatggtgacaagaaggattgtcaattcagataacttagtcaattat
cgtttaatcatggatgaaattgttgctgacagtaatctcatttatcgtgatttagttttc
ggaaacgaacatttctatgattatttcttcgcagctagtccaattcgcgaagtttcaagt
ttgaatattggttcccgtccagcagctcgtaagacgattacagagatcagcggtttgcgc
gctattccttgggtattctcatggtctcaaaatcgcatcatgtttccaggatggtacggt
gtcggttcagcctttaaacattttatagataaggatgaaaagaatttgactaaattgcag
gaaatgtatcaatcatggcctttcttccattcattgttgtcaaatgttgacatggtttta
tccaaatcaaatatgaatattgcctttgaatatgctaaattatgtcaggatgaagaaaca
aaagaagtctttgcaactattttggatgaatggcaattaaccaaaaatgttattctagca
attgaaagtcacaaacagcttttagaagataatagttatttgaaagctagtcttgattat
cgtttaccttactttaatgttttaaattatattcaaattgagttaattaaacgtcagcgc
cgtggtgaattaggtgagaatttagagaacctgattcacattactattaatggtgtcgca
actggtttacgaaattcaggttaa

DBGET integrated database retrieval system