KEGG   Streptococcus mutans NN2025: SmuNN2025_1358Help
Entry
SmuNN2025_1358    CDS       T01185                                 

Gene name
sod
Definition
(GenBank) putative manganese-type superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
smc  Streptococcus mutans NN2025
Brite
Enzymes [BR:smc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SmuNN2025_1358 (sod)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(1433490..1434137)
Genome map
AA seq 215 aa AA seqDB search
MKMYQKKKRGNDMAIFLPDLPYAYDALEPYIDAETMTLHHDKHHATYVANANAALEKHPE
IGENLEVLLADVEQIPADIRQALINNGGGHLNHALFWKLLSPEKTKVTAEVAAAVNEAFG
SFDDFKAAFTAAATTRFGSGWAWLVVDKEGKLEVTSTANQDTPISQGLKPILALDVWEHA
YYLNYRNVRPNYIKAFFEVINWNTVARLYAEALTK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgtatcaaaaaaagaaaagaggaaatgatatggctatttttttaccagatctt
ccatatgcttatgacgcacttgaaccatatattgatgctgaaacgatgacccttcatcat
gataagcatcatgcaacttatgtcgcaaacgctaatgcggctcttgaaaaacatccagaa
atcggagaaaatttggaagtacttttggctgatgtggaacaaattccagcggatattcgt
caggctttgattaataatggtggcggtcatcttaatcacgctcttttctggaaactcttg
tcgccagaaaagacaaaagttactgcggaagtagccgcagcagtcaatgaagcttttggc
tcatttgatgattttaaagcagcttttacagctgccgcaacgacgcgttttggctcaggt
tgggcttggttagtagttgataaagaaggaaaacttgaagtgacctcaacagctaatcaa
gatactccaatttcacagggcttgaaaccaattctagcacttgatgtctgggaacacgcc
tattatctcaattatcgtaatgttcgtccaaactatatcaaagccttctttgaagttatc
aattggaacactgttgctcgtctttatgccgaagctctcactaaataa

DBGET integrated database retrieval system