KEGG   Sinorhizobium medicae: Smed_0571Help
Entry
Smed_0571         CDS       T00555                                 

Definition
(RefSeq) glutathione S-transferase domain-containing protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
smd  Sinorhizobium medicae
Pathway
smd00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Smed_0571
Enzymes [BR:smd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Smed_0571
Transporters [BR:smd02000]
 Other Transporters
  Pores ion channels [TC:1]
   Smed_0571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 Tom37
Motif
Other DBs
NCBI-GeneID: 5321407
NCBI-ProteinID: YP_001326262
JGI: Smed0571
UniProt: A6U6Z7
LinkDB All DBs
Position
620204..620824
Genome map
AA seq 206 aa AA seqDB search
MLKLFYTPGTCSLASHIALEEAGAAYEVHRVDFSKAEQTKPDYLSINPKGRVPALVTDRG
ILTETPPILAYIAQSFPKARLAPLDDPFEFARLQSFVSYLCSTVHVAHAHARRAGRWADD
PAAQEAMKAKVPQNMGDCFALIERTMFAGPFVLGDSYSIADPYLFTIASWLESDGVDPAR
FPRILDHRNRMGERQAVAKVLAAVQA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaactgttttacacgcccggaacctgctcgcttgcctcgcatatcgcactcgag
gaggccggtgcggcttatgaagtgcatcgcgtcgatttttcaaaggccgagcagaccaag
ccggactatctctccatcaatccgaagggcagggtacccgcgttggtaaccgaccgcggt
attctgaccgaaacccctcccattctcgcatatatcgcccagagcttcccgaaggcgcgg
cttgcgccgcttgacgatcctttcgagttcgcgcggcttcagtcgtttgtcagctatctc
tgctcgactgtccacgttgcccatgcccatgcgcgtcgcgccgggcggtgggcggatgat
ccggcagcacaggaggcaatgaaggccaaggtgccgcagaatatgggcgactgcttcgcg
ctgatcgaacgaacgatgtttgccggccccttcgtcctgggcgattcctattcgatcgca
gacccttatctcttcaccatcgcaagctggctcgagtctgacggcgtcgacccggcgcgc
tttccgcgtatcctcgaccatcgcaaccggatgggcgaacgtcaggccgtggcaaaggtt
ctcgccgcagtgcaggcgtag

DBGET integrated database retrieval system