Sinorhizobium medicae: Smed_0746 Help Entry Smed_0746         CDS       T00555                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism smd  Sinorhizobium medicae Pathway smd01100   Metabolic pathways smd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Smed_0746   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Smed_0746 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N Delta_lysin Motif Other DBs NCBI-ProteinID:  ABR59602 UniProt:  A6U7H2 LinkDB All DBs Position 799846..800082 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDAEKVSEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtgaagaaaattgttattgatcatcttggcgtcgacgcc gaaaaggtcagcgaaggcgcaagcttcatcgatgacctcggcgcggactcgctcgacacc gtcgaactggtaatggcattcgaagaagaattcggtgtcgaaattccggacgacgctgca gattcgatcctcaccgtcggcgacgccgtgaagttcatcgagaaggcgcaggcctga

DBGET integrated database retrieval system