KEGG   Sinorhizobium medicae: Smed_2631Help
Entry
Smed_2631         CDS       T00555                                 

Definition
(RefSeq) DNA ligase D
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
smd  Sinorhizobium medicae
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:smd00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Smed_2631
Enzymes [BR:smd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Smed_2631
DNA repair and recombination proteins [BR:smd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Smed_2631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2731583..2734180
Genome map
AA seq 865 aa AA seqDB search
MAARNETLTEYNRRRDFTRTKEPKGTVARRSGNRMRFLVQKHAATRLHYDFRLEWEGVLK
SWAVTRGPSLNPEDKRLAVRTEDHPLAYGDFEGTIPKGEYGGGTVMLWDTGWWEPEDDPS
KALRKGKLSFKLHGSRMKGGWALVRMRPREGEKRENWLLVKETDEIASKDGESLINENIT
SVVTGRTMEEIAEGRGEKRSRVWHSNKSTAANLRAGAVAEDGNARKRPTRKPSGKLPTFR
APQLATLVTQVPVGDAWLNEAKFDGYRLVCALGGGTARCYTRNGLDWTEKFPVIAAALAE
LDCRSALIDGEVVALSEGGSTFSALQKALATGASTRLYAFDLIELDGKDLSRKPLVERKE
KLEALLQTLGTTSTIQFSEHVRGNGEHVLAAICKAGQEGIIAKEANAPYRSGRTRSWLKV
KCTKRQEFVIGGYSLSDKKGRAFASLIVGTFEGGKLIYRGGVGTGFSKKTMEDLAAAFAS
RKRETSPFDSIPRERMRHSVWLKPDLVAEVDFAEFTAEGHIRHGSFEGLREDKEAKAVKL
ETSKPAEVESGTTTKGKSTTKARRTSAAQGDADVLGIRISHPDRVLFKGQGITKIDLARY
YAIVADRMLPFAADHPVSLVRCPQGGERQCFFQKHASDGFPDAIREVPITESSGDTEDYM
YIHDAKGLVAAVQMGTLEFHIWGARTDRLEKPDRLVFDLDPDPSVDFATVKAAAVELRDE
LAGIGLKTVPMVTGGKGVHVIVPLRPHAEWDEVKGFAKALAQSFAERDPDHFVATMSKAK
RKGRIFIDWLRNDRGATAIAPYSTRARAGGPVATPVGWEELESLDAANGFHIPEILARIE
AGTDPWRDIGKISQSLTKKILNSVA
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atggccgctcgcaacgaaacacttaccgaatataacaggcgccgtgacttcacgcggacg
aaggagcccaagggaaccgtcgctcgtcgcagcgggaacaggatgcggttcctggtccag
aagcacgccgcaacccgcctgcattacgactttcgcctggaatgggagggcgtgctgaag
agctgggcggtgacgcgcggcccaagcctcaaccccgaggacaagcgccttgccgtccgc
accgaagaccacccgcttgcttatggcgacttcgaaggaaccatcccgaagggagaatat
ggcggcggcaccgtgatgctctgggatacgggctggtgggagccggaggatgacccgtcc
aaagccttgaggaagggcaagctctccttcaagctgcatggcagccgcatgaagggaggc
tgggctctggtacgcatgcgcccacgcgaaggcgagaagcgcgagaactggctgctcgtc
aaggaaacggatgagatcgcctccaaggatggcgagagcctgatcaacgaaaacatcacc
agcgtcgtcaccggtcgcaccatggaagagatcgccgaaggcaggggcgaaaagcgctca
cgcgtctggcactcgaacaaaagcacggcggccaatctcagggccggcgcggtcgctgaa
gacggcaatgcacgcaagcgccccacgcgaaagccctcaggcaaactgcctaccttccgg
gcgcctcagctggcgacgctggtgacccaggtacccgtgggcgacgcgtggctgaacgaa
gccaagttcgacggctaccggcttgtttgcgccctgggcggcggtactgcccgctgctac
acgcgcaacggactcgattggaccgaaaagttcccggtcattgccgcagcccttgccgaa
ctcgactgccggtccgcccttatcgacggcgaagtcgtagcactgtcagaaggcgggtcc
actttctccgccctgcagaaagcgcttgcaacaggggccagcacacggctttacgcgttc
gatctcatcgagctcgacggcaaggatttgagcagaaagccgctcgtggagcgcaaggaa
aagctcgaagcgctgctccaaacgctgggcacgacctcgaccatccagttcagcgagcat
gttcgcgggaatggcgagcacgtgcttgccgccatatgcaaggctggtcaggagggtata
atcgccaaggaggcgaacgccccctaccggagcgggcgcacccgaagctggctcaaggtg
aaatgcaccaaacgccaggaattcgtcatcggcggctacagcctgtcggacaagaagggg
cgcgccttcgcctcgctcatcgtcgggactttcgaaggcgggaagctgatctatcgtggc
ggggtcggaaccggtttcagcaaaaagacgatggaggacctcgccgcagccttcgcctca
cgcaaaagagaaacgtcgcccttcgacagcataccgcgagagagaatgcgacattcagtt
tggctgaagccggacctggtggccgaggtagacttcgccgaattcacggctgaaggccat
atccgccacggttcgttcgagggattgcgcgaggacaaggaggcaaaggccgtgaaactg
gagacatcgaagccagcggaagtggagtccgggaccaccaccaagggtaaatccaccaca
aaggcgcgcaggacatcggccgcacaaggtgacgccgacgtcctcggcatccgtatttcg
catccggaccgcgtcctgttcaaaggtcagggcatcaccaagatcgatcttgcccgctat
tatgcaatcgtcgccgacaggatgctcccctttgccgccgaccatcccgtctcgctggtg
cgctgcccgcagggcggcgagcggcagtgcttcttccagaagcacgcaagcgacggcttt
cccgatgcgatcagggaagtgcccatcaccgaatcgtcgggagacaccgaagactacatg
tatatccacgatgccaaggggctcgtcgcagcagtacagatggggacgctcgaatttcac
atctggggcgcaaggaccgatcggctggagaaacccgatcggctggtcttcgatctcgac
cccgatccaagcgtcgacttcgcaaccgtcaaagcagcggccgtagagcttcgcgacgag
ctcgccgggatcggcctgaaaaccgtgccgatggtgacgggcggcaagggagtccacgtg
atcgtgccgctccgcccccatgccgaatgggatgaagtaaaagggttcgccaaggcgctc
gcgcaatcttttgccgagcgcgatccggatcatttcgtcgcgaccatgtccaaggccaag
cgcaaggggaggattttcatcgactggctgcgcaacgaccgcggcgccacggcgatagcc
ccctactccacccgtgcgcgcgccggcggaccggtcgccactccggtcggctgggaggag
cttgaaagcctcgatgccgccaatgggtttcatattcccgaaattctcgcacgcatcgag
gccggaaccgatccctggcgggacatcggcaagatcagtcagtcgctgacgaagaagatc
ctgaactcggtcgcgtga

DBGET integrated database retrieval system