KEGG   Sinorhizobium medicae: Smed_3925Help
Entry
Smed_3925         CDS       T00555                                 

Definition
(RefSeq) ribulose-bisphosphate carboxylase
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
smd  Sinorhizobium medicae
Pathway
smd00630  Glyoxylate and dicarboxylate metabolism
smd00710  Carbon fixation in photosynthetic organisms
smd01100  Metabolic pathways
smd01120  Microbial metabolism in diverse environments
smd01200  Carbon metabolism
Module
smd_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Smed_3925
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Smed_3925
Enzymes [BR:smd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Smed_3925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 5318761
NCBI-ProteinID: YP_001312668
JGI_p1: Smed3925
UniProt: P56890
LinkDB All DBs
Position
pSMED01:378252..378641
Genome map
AA seq 129 aa AA seqDB search
MRITQGCFSFLPDLTDEQITAQVEYCLGRGWAIGVEYTDDPHPRNTYWEMWGNPMFDLRD
AKGVMMEVEDCRKAHPQDYIRLNAFDSSRGLETVTMSFIVNRPENEPSLRMTRTESDGRS
QHYTWETQR
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcacccagggatgcttctcgttcctgccggacctgacggacgagcagataacg
gctcaggtggaatattgcctcggaaggggctgggctatcggcgtcgaatacaccgacgac
ccgcatccccgtaacacctattgggaaatgtggggcaatccgatgttcgacctgagggac
gcaaaaggcgtgatgatggaggtggaggattgccgcaaggctcatccccaggactatatc
cgactgaacgccttcgattccagccgcggccttgagacggtgacgatgtccttcatcgtc
aaccgtcccgagaacgaaccgagcctcaggatgacccgaacggagagcgacggccgcagc
cagcactatacgtgggaaacacagcgatag

DBGET integrated database retrieval system