KEGG   Sinorhizobium meliloti 1021: SMc00043Help
Entry
SMc00043          CDS       T00058                                 

Gene name
sodB
Definition
(RefSeq) superoxide dismutase Fe protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sme  Sinorhizobium meliloti 1021
Brite
Enzymes [BR:sme01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SMc00043 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 1232616
NCBI-ProteinID: NP_385079
RhizoBase: SMc00043
UniProt: Q9XD74
LinkDB All DBs
Position
1067033..1067635
Genome map
AA seq 200 aa AA seqDB search
MAFELPNLPYDYDALAPYMSRETLEYHHDKHHLAYVTNGNKLAEEAGLSDLSLEDIVKKS
YGTNQPLFNNAGQHYNHVHFWKWMKKGGGGTSLPGKLDAAIKSDLGGYDKFRADFSAAGA
GQFGSGWAWLSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA
FVDNLINWDYVLELYEAAAK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgccgaaccttccctatgactacgatgcgcttgcgccctacatgtcg
cgcgaaacgctcgaataccatcacgacaagcaccacctcgcttacgtgacgaacggcaac
aagctcgccgaggaagccggtctttccgatctttcgctggaagatatcgtcaagaagtcc
tacggcaccaatcagccgttgttcaacaatgccggccagcactacaaccacgttcacttc
tggaagtggatgaagaagggcggcggcggcaccagcctgcccggcaagctcgacgcggcg
atcaaatcggacctcggcggctacgacaagttccgcgccgatttcagtgctgccggcgca
ggtcagttcggctcgggctgggcctggctttccgtgaagaacggcaagctggaaatctcc
aagaccccgaacggcgagaacccgctcgtccacggcgcaaccccgatcctcggcgtcgat
gtgtgggagcattcctattacatcgactatcgcaacgcgcgtccgaaatacctggaagcc
ttcgtcgacaatctcatcaactgggattacgtcctcgagctgtacgaagcggctgcaaag
taa

DBGET integrated database retrieval system