KEGG   Sinorhizobium meliloti RMO17: DU99_05685Help
Entry
DU99_05685        CDS       T03395                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
smer  Sinorhizobium meliloti RMO17
Brite
Enzymes [BR:smer01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DU99_05685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AIL98920
UniProt: A0A222KTP8
LinkDB All DBs
Position
1185301..1185819
Genome map
AA seq 172 aa AA seqDB search
MMRTMIAIACAAGMAGAASAQQSSQTATAEFVGKDGTDIGRATLTAGGKGVLIEMEISGL
PKDTWVAFHAHEMGRCDPKDGFESAGKHFAGEDENAEHGFLASNGPHAGDMPNQYVGADG
TLRAQVFNSFVSLDDRATALRGRALVIHVHSDDNRSQPSGDAGDRLACAVVK
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgatgagaacgatgattgcgatcgcctgtgcggcaggaatggcgggtgccgcttcggca
caacagtcctcgcagacggcgacggccgagttcgtgggcaaggacggcacggacatcggc
cgggccactttgacggcaggcggcaagggcgtgctgatcgagatggagataagcggcctg
ccgaaggatacctgggtggcttttcacgctcacgaaatggggcgctgcgatcccaaggac
gggttcgagtcggcgggaaagcattttgccggcgaagatgagaatgccgagcacggcttc
ctcgcttccaatggcccgcatgccggcgacatgccgaaccagtatgtcggtgccgatgga
accttgcgcgcccaggtcttcaacagcttcgtgtccctcgacgacagggctaccgccctt
cgcggccgggccctggtgatccatgtgcattcggacgacaatcgcagccagccctccggc
gatgccggcgaccggctggcctgcgcggtggtgaagtag

DBGET integrated database retrieval system