KEGG   Sinorhizobium meliloti AK83: Sinme_0683Help
Entry
Sinme_0683        CDS       T01521                                 

Definition
(GenBank) Manganese/iron superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
smk  Sinorhizobium meliloti AK83
Brite
Enzymes [BR:smk01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Sinme_0683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
1:715084..715686
Genome map
AA seq 200 aa AA seqDB search
MAFELPNLPYDYDALAPYMSRETLEYHHDKHHLAYVTNGNKLAEEAGLSDLSLEDIVKKS
YGTNQPLFNNAGQHYNHVHFWKWMKKGGGGTSLPGKLDAAIKSDLGGYDKFRADFIAAGA
GQFGSGWAWLSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA
FVDNLINWDYVLELYEAAAK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgccgaaccttccctatgactacgatgcgcttgcgccctacatgtcg
cgcgaaacgctcgaataccatcacgacaagcaccacctcgcttacgtgacgaacggcaac
aagctcgccgaggaagccggtctttccgatctttcgctggaagatatcgtcaagaagtcc
tacggcaccaatcagccgttgttcaacaatgccggccagcactacaaccacgttcacttc
tggaagtggatgaagaagggcggcggcggcaccagcctgcccggcaagctcgacgcggcg
atcaaatcggacctcggcggctacgacaagttccgcgccgatttcattgctgccggcgca
ggtcagttcggctcgggctgggcctggctttccgtgaagaacggcaagctggaaatctcc
aagaccccgaacggcgagaacccgctcgtccacggcgcaaccccgatcctcggcgtcgat
gtgtgggagcattcctattacatcgactatcgcaacgcgcgtccgaaatacctggaagcc
ttcgtcgacaatctcatcaactgggattacgtcctcgagctgtacgaagcggctgcaaag
taa

DBGET integrated database retrieval system