KEGG   Stenotrophomonas maltophilia K279a: Smlt0778Help
Entry
Smlt0778          CDS       T00718                                 

Gene name
ppc
Definition
(GenBank) putative phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml00620  Pyruvate metabolism
sml00680  Methane metabolism
sml01100  Metabolic pathways
sml01120  Microbial metabolism in diverse environments
sml01200  Carbon metabolism
Module
sml_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Smlt0778 (ppc)
  Energy metabolism
   00680 Methane metabolism
    Smlt0778 (ppc)
Enzymes [BR:sml01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Smlt0778 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: CAQ44354
UniProt: B2FPC5
LinkDB All DBs
Position
815468..818179
Genome map
AA seq 903 aa AA seqDB search
MNEYRSSIEFASPDLPLRDDVRRLGALVGDLLVEQVSAAFLDDVEDVRTRAIARRENQAP
LSELADGLAGRTPQQAETMVRAFSTYFQVVNIAERVHRIRRRRDYQRAGTAGAQPDGLQD
ALQHLKAQGVGLDELAQWLPRIDIEPVFTAHPTEAVRRALLEKEQLMVASLVDNLDGQRT
PGEAAADAARFRMALTASWQTTDSSPVRPTVDDEREHVGFYLVQVLYRVIPVLYESLQQA
LRDTYGEELPLPRLLRFGTWVGGDMDGNPNVDAHTIRNTLDAQRQAVLGRYQKELLQLAS
LLSQSTERVGVSDALQARVAQYQQLLPQVQSRPRHADMPYRLLNDRMRARLQATLDNGGG
AYAGPAELIDDLQLILDSLLANRGEHAGGFAVQRLLWRVKTFGFHLARLDVRQESSVHAR
ALAAVLGGEEAWQALDVAGRARLLSPHASGETALPNGDDEGNQRLDAVFAALADARARHG
SDALGSYIISMAHDRSDVLAVLALARRGGLVEENGSVPLDIAPLFETVDDLKRGTATLRD
LLADPIYRAHLQARDDVQMVMLGYSDSSKDGGIAASRWGLQRAQVELLEVAAEAGIRLTF
FHGRGGSISRGGGKTTHAVDASPRGSIDGRLRVTEQGEVIHRKYGIRALALRSLEQATGA
VLRASLRPRAAEPREDDWRPVMDAVAGASSEVYRAFVGQAGFMDYFRTATPIDVIERMTL
GSRPSRRLGQDAALGNLRAIPWVFAWSQARAVIPGWYGVGSGLQAAVDAGHEQTLRDMAR
DWPFFRTFLDDISMVLSKGDITIAEQFSQLSGELHGRFFPQVQRELELTRHWLLALMDQQ
TLLDHDARLALSIRLRNPYVDPISMLQVDLLQRWRASGREDDDLLRALVACVNGVSQGVQ
NTG
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagtaccgcagcagcatcgagtttgcttctcccgatcttccgcttcgcgatgat
gtgcgccggcttggcgcactggtcggcgacctgctggtcgaacaggtgtcggccgcgttt
cttgatgacgtcgaggacgtgcgtacccgcgccatcgcccgtcgcgaaaaccaggcgccg
ctgtcggagctggccgatggcctggccgggcgcacgccgcagcaggccgagaccatggtg
cgggccttcagcacctacttccaggtggtcaacatcgccgagcgcgtgcatcgcatccgc
cgccgccgtgactaccagcgcgccggtaccgcaggggcgcagcccgatggcctgcaggat
gcactgcagcacctgaaggcgcagggcgtgggcctggacgaactggcgcagtggctgccg
cgcatcgacatcgaaccggtgttcaccgcgcatccgaccgaagccgtgcgccgcgcgttg
ctggaaaaagagcagctgatggtggccagcctggtcgacaacctcgacggccagcgcacc
ccgggtgaggccgccgccgatgccgcgcgcttccgcatggcgctgaccgcgtcgtggcag
accaccgattcctcaccggtgcggccgaccgtggatgacgagcgcgagcacgtcggcttc
tacctggtgcaggtgctgtaccgggtgatcccggtgctgtacgaatcgctgcagcaggcg
ctgcgcgatacctacggcgaagaactgccgctgccgcgcctgctgcgctttggtacgtgg
gtgggcggcgacatggacggcaatccgaacgtggatgcccacaccatccgcaatacgctg
gatgcgcagcggcaggcggtgctcgggcgctaccagaaggaactgctgcagctggccagc
ctgctcagccagtccaccgagcgggtaggggtgagcgatgcgctgcaggcgcgcgtggcg
cagtaccagcagctgctgccgcaggtgcagtcgcgcccgcgccacgccgatatgccgtac
cgcctgctcaacgaccgcatgcgcgcacgcctgcaggccacgctggacaatggcgggggc
gcctacgccggccccgccgaattgatcgacgacctgcagctgatcctcgacagcctgctt
gcgaaccgtggcgagcacgctggtggttttgccgtgcagcgcctgctgtggcgggtgaag
accttcggcttccatctggcgcggctggatgtgcgccaggagtcgagcgtgcatgcgcgc
gcgctggccgccgtgctgggtggcgaagaggcctggcaggcgctggatgtggcgggccgt
gcgcggctgctgagcccgcatgccagcggtgaaacggcattgcccaacggcgacgacgag
ggcaaccagcggctggacgcggtgttcgctgcactggccgatgcgcgtgcgcggcatggc
agcgatgcgctgggcagctacatcatctcgatggcgcacgaccgcagcgacgtgctcgcg
gtgctggcgctggcacgccgtggcggcctggtggaagagaacggatcagtaccgctggat
atcgcaccgctgttcgagacggtggatgatctcaagcgcggcaccgcgaccctgcgtgac
ctgctggccgacccgatctatcgcgcgcacctgcaggcacgcgacgacgtgcagatggtg
atgctgggctactcggacagcagcaaggacggtggcatcgctgcctcgcgctggggcctg
cagcgtgcacaggtggagctgctggaggtggcggccgaggcgggcatccgcctgaccttc
ttccatggccgtggcggctcgatcagccgtggcggtggcaagaccacgcacgcggtggat
gcttcaccacgcggcagcatcgatggccgcctgcgggtgaccgagcagggcgaggtgatt
catcgcaagtacggtatccgcgcgctggctttgcgctcgctggaacaggccaccggcgcg
gtgctgcgcgccagcctgcgcccgcgtgctgccgagccccgcgaggacgactggcggccg
gtgatggatgcggtggctggggccagcagtgaggtgtatcgcgcgttcgttggccaggcc
ggcttcatggattacttccgtaccgccacgccgatcgatgtgatcgagcggatgacgctg
ggctcgcgtccgtcgcgccggctcggccaggacgcagcactgggcaacctgcgcgcgatt
ccgtgggtattcgcctggagccaggcacgcgcggtgattcccggttggtatggcgtgggc
agtggcctgcaggcggcggtggatgccggccacgaacagaccctgcgcgatatggcgcga
gactggccgtttttccgtacgttcctggacgatatctcgatggtgctgtccaagggcgat
atcaccatcgccgagcagttctcgcagctgtccggcgagttgcacgggcgcttcttcccg
caggtgcagcgcgaactggaactcacccggcactggctgctggcattgatggaccagcag
acgctgctggaccacgatgcgcggctggcgctgtcgatccgcctgcgcaatccctatgtc
gatccgatcagcatgctgcaggtggacctgctgcagcgctggcgggccagcggacgcgag
gatgacgatctgctgcgtgcgctggtggcgtgcgtgaacggtgtttcacagggcgtgcag
aacaccgggtga

DBGET integrated database retrieval system